KEGG   Lactobacillus johnsonii NCC 533: LJ_1197
Entry
LJ_1197           CDS       T00158                                 

Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00550  Peptidoglycan biosynthesis
ljo01100  Metabolic pathways
ljo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LJ_1197
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    LJ_1197
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ljo01003]
    LJ_1197
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
    LJ_1197
Enzymes [BR:ljo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     LJ_1197
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LJ_1197
Glycosyltransferases [BR:ljo01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   LJ_1197
Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   LJ_1197
SSDB
Motif
Pfam: Transgly Transpeptidase
Other DBs
NCBI-ProteinID: AAS09018
UniProt: Q74JB2
LinkDB
Position
1122231..1124618
AA seq 795 aa
MADNNQRPSNSRMAKLHPKGKPRKRIWLQIIKWFFIVAMLVVVSGVGLFAYYAKDAPSIS
QAQLQSGGTSSLYTRDGKFLLSLGSEKRTYVDNNEIPKELKNAIVSVEDRRFYKEGIGLD
PIRIIGSVLVNAKSKGVAAGGSTITQQLVKLSVFSTAASQRTLRRKAQEAWLSMKVEREF
SKEQILEFYINKVYMNYGNYGMGTAADYYYGKDLKDLDLAQTALLAGMPNAPVTYDPYVY
PEKAKYRRDIVLKAMLRNDKISRAQYKQAVNEPITQGLQPKKNNSTSELRKVDDPYIKEV
INEVKSKGFNPYNDNLKITVNIDQDAQQKLYDLVNDGSVPFTNDKMQVGATIIDPRTGHV
IAIIGGRKLPAVQLGLNRAVQTGRSTGSTVKPVLDYGPAIEYLNWPTSHMLDDSKYVYPG
TNIQLYDWDNKYEGKMTMRHALEQSRNVPAVKTLSKVGVARASLFARKLGVNVPSDSGLS
VAIGANASSLQMAGAFGAFANDGIYHKPQFVSKIETPDGLTRNYDSSGTRVMKESTAYIM
TDMLKGVMTKGSGTQARIKNLYEAGKTGTVKYSDEELVRYPQYKNSPKDSWFVGYTKLYS
MGIWTGYDNLKDGTPSGVGSSSAQLLYKQMMSYLMSDKANKDWSKPSTVVRRRIANGTQD
KVVSPNASNSSWQLFVKGHAPSNPYSDVTVDRRKEEDDDIDTRVDTEDDTSSKGQSRSQS
SSSSSSSRAEQSSSQRQSSSTSNNNSNTQTQNNNRQTEKQPENNNNNSQQNQNTNNQGNN
QNQQQNQGNNSNNNQ
NT seq 2388 nt   +upstreamnt  +downstreamnt
atggcagataataatcaaaggccaagtaattctagaatggctaagcttcacccaaaaggt
aagcctcgtaaacgaatttggctacaaataatcaagtggttctttatcgtagcaatgtta
gtagttgtttctggagtaggtttatttgcatactatgctaaagacgctccaagcatctca
caggctcaacttcaaagtggtgggacaagtagtctgtatactcgtgatggaaaatttctt
ctttctctagggtcagaaaaaagaacctatgttgataataatgaaatccctaaagaactt
aaaaatgccattgtctctgttgaagataggcgtttttataaagaaggcattggactcgat
ccaattagaattattgggtctgtcttagttaatgctaaaagtaaaggcgtagctgcaggt
ggatcaactattactcagcaattagttaagttatcggtcttctccactgctgcttctcaa
agaacccttcgtagaaaagctcaagaagcatggctttcaatgaaggtagaacgagaattt
agcaaagaacaaatcttggaattttatattaataaagtttatatgaactatggtaattac
gggatgggtacagcagccgactattactatgggaaagatctaaaagatcttgatttagct
cagactgctctacttgctgggatgcctaatgccccggttacatatgatccatatgtttat
ccagaaaaagcaaaatatagacgtgacattgtattaaaagcaatgctcagaaatgataaa
atttcaagagctcaatataaacaagcagttaatgagcccattactcaaggcttgcagcct
aagaagaataattctacttctgaattacgaaaagtagatgatccatacatcaaagaagta
attaatgaagttaagagtaaaggctttaatccatacaacgataacttaaagattacagtt
aatattgatcaagatgctcaacaaaagctttatgacttagtaaatgatggttcggttcca
tttactaatgataagatgcaagttggagctacaattattgatcctcgaactggccatgtt
attgccattattggtggacgtaaacttcctgcagttcaattaggtttaaatcgtgctgtt
caaactggtcgttcaactggttctactgttaagcctgtattagattatggtcctgcaatt
gagtatcttaactggccaacttctcatatgttagatgactctaaatatgtttaccctggt
actaacattcaactttatgactgggacaataaatatgagggtaaaatgactatgcgtcac
gctcttgaacaatctagaaatgttccagctgttaaaactttaagcaaggttggagtggca
agagcttctctttttgcaagaaaactcggagttaatgttccttctgattctggtctatca
gttgcaattggtgctaatgcatcctctcttcaaatggcaggcgcatttggtgcatttgct
aatgacggtatttaccacaaaccacaatttgtttcaaaaattgaaactccagacggcttg
actagaaattatgatagtagtggtacaagagtaatgaaggaatcaaccgcctatattatg
accgacatgcttaaaggggttatgactaaaggttcgggtacacaggcacgtattaaaaac
ttatacgaagctggtaaaacaggaacggttaaatattctgatgaagagttagtaagatat
cctcaatacaaaaattcaccaaaagattcttggtttgttggttataccaaactctattca
atgggaatttggacaggatatgataatctgaaagatggtactccttcaggtgttggctca
tcgtctgctcaacttctatataagcaaatgatgtcatatttaatgagtgataaagctaat
aaagactggtcaaaaccaagcacagttgttagacgcagaattgctaatggtacccaagat
aaagtcgtttctccgaatgcaagtaattctagctggcaattatttgttaaaggtcatgca
ccaagtaatccgtatagtgatgtgactgttgatagacgaaaagaggaagacgacgatatt
gatacacgagttgatacagaagatgatacttcttctaagggccaatctcgttcccaaagc
agtagttcttcatcatcgagtcgtgctgaacaatcttcaagtcaaagacaatcttcttct
acttctaacaacaactccaatactcaaacgcaaaataataatcgccagactgaaaaacaa
ccagaaaataataacaataattcacaacagaatcagaatacaaataatcagggtaacaat
caaaatcaacaacaaaatcagggaaataactccaataataatcaataa

DBGET integrated database retrieval system