KEGG   Lactococcus lactis subsp. lactis Il1403: L0196
Entry
L0196             CDS       T00045                                 

Gene name
trxB1
Definition
(RefSeq) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:lla00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    L0196 (trxB1)
Enzymes [BR:lla01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     L0196 (trxB1)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox DAO FAD_oxidored GIDA FAD_binding_2 Thi4 HI0933_like NAD_binding_8 FAD_binding_3 NAD_binding_7 K_oxygenase Lycopene_cycl Shikimate_DH Trp_halogenase
Other DBs
NCBI-GeneID: 1114571
NCBI-ProteinID: NP_267096
UniProt: Q9CH02
LinkDB
Structure
PDB: 

Position
965452..966378
AA seq 308 aa
MTEKKYDVVIIGSGPAGMTAAMYTARSEMKTLLLERGVPGGQMNNTAEIENYPGYETIMG
PELSMKMAEPLEGLGVENAYGFVTAIEDHGDYKKIITEDDEFVTKSIIIATGANHRKLEI
PGEEEYGARGVSYCAVCDGAFFRNQEILVIGGGDSAVEEALYLTRFGQSVTIMHRRDKLR
AQEIIQQRAFKEEKINFIWDSVPMEIKGDDKKVQSVVYKNVKTGEVTEKAFGGIFIYVGL
DPVAEFAGNLGITDEAGWIITDDHMRTSLPGIFAVGDVRQKDFRQITTAIGDGAQAAQEA
YKFVAELD
NT seq 927 nt   +upstreamnt  +downstreamnt
atgacagaaaagaaatatgatgttgtcatcattggttcaggccctgcgggaatgactgca
gcgatgtatactgcacgttctgaaatgaaaactttgcttttagaacgtggtgttcctggt
ggtcaaatgaataacacagctgagattgaaaattatcctggctatgaaacaatcatgggt
cctgaactttcaatgaaaatggctgaacctttggaaggtttaggtgtagaaaatgcttat
ggttttgtgacggctattgaagaccatggggattacaaaaaaattatcacagaagatgat
gagtttgtcactaaatcaattattattgcgacaggagctaatcaccgtaagcttgaaatt
cccggtgaggaagaatatggagctcgcggagtttcctactgtgccgtttgtgatggtgct
ttctttagaaaccaagaaattttagttattggtggtggtgactctgctgttgaagaagct
ctctacttgactcgttttggtcaatcagtaacaattatgcatcgtcgtgataaattgcgt
gcacaagaaattatccaacaaagagctttcaaagaagaaaaaatcaactttatttgggat
tctgttcctatggaaattaaaggggatgacaaaaaagttcaatccgttgtttataaaaac
gttaaaacgggtgaagtaactgaaaaagcttttggtggaatcttcatttatgtgggactt
gacccagttgctgaatttgctggtaatcttggaattactgatgaagccggttggattatt
accgatgaccatatgagaacaagtctacctggtatttttgccgtaggtgatgttcgtcaa
aaagatttccgtcaaatcactacagctattggtgatggagcgcaagcagctcaagaagct
tataaatttgtagctgaacttgattaa

DBGET integrated database retrieval system