KEGG   Lactococcus lactis AI06: LG36_0764Help
Entry
LG36_0764         CDS       T03480                                 

Gene name
accC
Definition
(GenBank) Acetyl-CoA carboxylase, biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
llj  Lactococcus lactis AI06
Pathway
llj00061  Fatty acid biosynthesis
llj00620  Pyruvate metabolism
llj00640  Propanoate metabolism
llj01100  Metabolic pathways
llj01110  Biosynthesis of secondary metabolites
llj01120  Microbial metabolism in diverse environments
llj01130  Biosynthesis of antibiotics
llj01200  Carbon metabolism
llj01212  Fatty acid metabolism
Module
llj_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:llj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LG36_0764 (accC)
   00640 Propanoate metabolism
    LG36_0764 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LG36_0764 (accC)
Enzymes [BR:llj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     LG36_0764 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     LG36_0764 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATP-grasp_4 ATP-grasp_5 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AIS03364
UniProt: A0A2A9I487
LinkDB All DBs
Position
827312..828679
Genome map
AA seq 455 aa AA seqDB search
MFNKILIANRGEIAVRIIRAARELGVGTVAIYSTADRDALHVHLADEAICVGPARSTESY
LNMNNILSAAVATGAQAIHPGFGFLSENSKFARLCEEMNIKFIGPSAKVMDMMGDKINAR
AEMIKAGVPVTPGSEGEVHTTDEAVKIAEEIGYPIMLKASAGGGGKGIRKVNNVEELVPA
FEAAQAEAQAAFGNGAMFIERMIFPARHIEVQILGDSQGNVIHLGERDCSLQRNNQKVLE
ESPSVAIGHTLRQEITAAAVKAAQHVSYENAGTIEFLLDESSGKFYFMEMNTRVQVEHPV
TEFVSGVDIVKEQIRVANGNELSVKQEDVTFSGHAIECRINAENPKFNFAPSPGKITNLF
LPSGGVGLRVDSAMYSGYSIPPYYDSMIAKVIVHGENRFEALMKMQRALLEFDVEGVITN
VDFQLELISDPHVVAGDYDTSFLGNVFLPEYQKED
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtttaataaaattttgattgccaatcgtggcgaaattgctgtaagaattattcgtgca
gctcgcgaattaggagtgggtacagttgccatttattcaactgcagaccgcgatgcttta
catgttcatttagctgacgaagcaatttgtgtgggcccagctagaagtactgagtcttat
cttaatatgaataatattctgtcagctgctgtggcaactggcgcacaagcgattcaccca
ggttttggattcctttctgagaattcaaaatttgctcgtctttgtgaagaaatgaatatt
aaatttatcggtccgtcagcaaaagttatggatatgatgggtgataaaatcaatgctcgt
gcagaaatgattaaagctggtgttcctgtaacaccgggttctgagggcgaagttcatacc
actgatgaagcagtaaaaattgctgaagaaattggctatccaatcatgcttaaagcatca
gctggtggtggtggtaaaggaattcgtaaggttaataatgttgaggaacttgttccagca
tttgaggcagcccaagcggaagcacaagctgctttcggtaatggagccatgttcatcgaa
cgaatgattttcccagcgcgtcatattgaggttcaaatcttaggagatagtcaaggaaat
gtgattcatcttggtgaacgtgattgttcattgcaaagaaataaccaaaaagttcttgaa
gaatctccgtcagttgcaattggacacactttacgtcaggaaataacagctgcagctgtt
aaagctgctcagcatgtttcttatgaaaatgcaggaaccattgagttcttacttgatgag
tcttctggtaagttttatttcatggaaatgaacacacgtgttcaagttgaacatccggtc
acagagtttgtatcaggtgttgatattgtaaaagaacaaattcgtgtagccaatggcaat
gagttgtctgtcaagcaagaagatgtgacttttagtggacatgcgattgaatgtcgaatt
aatgcggaaaatcctaaatttaattttgcaccaagtccaggaaaaattactaatcttttc
ttgccaagtggtggagttggtttgcgggttgatagcgctatgtatagtggttacagcatt
ccgccatattatgatagtatgattgctaaagtcattgttcatggtgaaaatcgttttgaa
gcactgatgaaaatgcaacgcgcccttcttgaatttgacgttgaaggggtcattacaaat
gttgatttccaactagaattaatttctgatccacatgttgtggcaggagattatgataca
agcttcttaggaaatgttttcttaccagaatatcaaaaagaagattaa

DBGET integrated database retrieval system