KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_05680Help
Entry
LLNZ_05680        CDS       T02131                                 

Definition
(GenBank) GlpD protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
lln00564  Glycerophospholipid metabolism
lln01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lln00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LLNZ_05680
Enzymes [BR:lln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LLNZ_05680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like NAD_binding_8 FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ADJ60103
LinkDB All DBs
Position
complement(1057922..1059499)
Genome map
AA seq 525 aa AA seqDB search
MSISRQKNIEYLKANPDDWDFIIIGGGATGLGVAVDAASRGYKTVLVEQSDFAKSTSSRS
TKLVHGGVRYLAQGDVSLVREALHERGRLARNAPHLVKNQKFIIANYKAWEQPFYSIGMK
MYDALAGKLNIGKSKIYSKKKVAEAIPQIKHEHLVGGVMYYDGQFDDARMAINLMQTATE
QGALLVNYVKVTELVKTDSKVSSVKLHDELSGESFELHGKAIINATGIFVDQIMSMDTKE
HKPSVRPSQGVHLIVDGSFLGGQDAIMVPKTSDGRVLFCVPWHNKVILGTTDTPLTEFVL
EPRPLEEEIDFILETAGQYLEKKPERKDVLTAYAGLRPLAAPKEGDGEKTKEISRSHKLF
TSESGLVTITGGKWTTYRQMAEETVDLAIKTSKLPEKKCITRTLKIHGAKETTERERQNW
LYVYGSDKGKILALQNEDSSLALPLHPKYEFTGSEVIWAVREEMAQTLDDVLARRIRALF
LDARIAKEMAPKVAQLMSKEMGKDEAWEKEQVESFLTLADGYILK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtctatctctcgtcaaaaaaatattgaatatttaaaagcaaatcccgatgattgggac
ttcattattatcggtggtggagcaaccggacttggagttgcggttgacgccgcatcacgc
ggttataaaacagttctagttgaacaaagtgactttgcaaaatcaacttcaagccgctcg
acaaaacttgttcacggtggcgttcgctaccttgctcaaggagatgtcagccttgttcgt
gaagcattacatgaaagaggtcgccttgctcgcaacgctccccatcttgtaaaaaatcaa
aaatttatcattgctaattacaaagcttgggagcaaccattttatagcatcggaatgaaa
atgtatgatgctttggcaggtaaattgaatattggaaaatcaaaaatttattctaagaaa
aaagttgctgaagcaattcctcaaatcaaacatgaacatctcgtcggaggagtcatgtat
tatgacggacaattcgatgatgctagaatggctatcaaccttatgcaaactgccactgaa
caaggtgcgctactagttaattatgtcaaagtgactgagcttgttaaaacggactcaaaa
gtatcttctgttaaacttcatgatgaactttctggcgaatcatttgaacttcacggaaaa
gccatcatcaacgctacaggaatctttgttgaccaaattatgtcaatggataccaaagaa
cacaaaccctctgttcgtccttcacaaggcgtccacctcattgttgacggctcatttctc
ggtggtcaagatgccatcatggttccaaaaacttctgacgggcgtgtcttgttctgtgtc
ccttggcataataaagtaatcttaggaacgacagatacacctcttacagaattcgtttta
gaacctcgaccacttgaagaagaaattgatttcatcttagaaactgctggtcaatattta
gaaaagaaacccgaacgtaaagatgttttaactgcttatgctggtttacgtccacttgct
gctcccaaagaaggcgatggcgaaaaaacgaaagaaatttcaagaagtcataaactcttc
acctctgaatcaggactggtcacaattactgggggaaaatggacaacttatcgccaaatg
gccgaagaaactgttgatttagcaatcaaaacctctaaacttcctgaaaaaaaatgtatc
accagaacattgaaaatacatggggccaaagaaacaactgaaagagaacgtcaaaactgg
ctctatgtttacggttctgataaaggaaagattttagctctccaaaatgaagactcttct
ttagccttacctcttcacccaaaatacgaatttacaggttctgaagtcatctgggctgtc
cgtgaagaaatggctcaaactctagatgatgttctcgctcgtcggattcgtgcacttttc
cttgatgcaagaattgccaaagaaatggctcccaaagtcgcccaactgatgtcgaaagaa
atggggaaagatgaagcatgggaaaaagaacaagttgagagcttccttactttagctgat
ggttatattttaaaataa

DBGET integrated database retrieval system