KEGG   Legionella longbeachae: LLO_2636
Entry
LLO_2636          CDS       T01183                                 

Gene name
holC
Definition
(GenBank) putative DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
llo  Legionella longbeachae
Pathway
llo03030  DNA replication
llo03430  Mismatch repair
llo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:llo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    LLO_2636 (holC)
   03430 Mismatch repair
    LLO_2636 (holC)
   03440 Homologous recombination
    LLO_2636 (holC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:llo03032]
    LLO_2636 (holC)
   03400 DNA repair and recombination proteins [BR:llo03400]
    LLO_2636 (holC)
Enzymes [BR:llo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     LLO_2636 (holC)
DNA replication proteins [BR:llo03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     LLO_2636 (holC)
DNA repair and recombination proteins [BR:llo03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     LLO_2636 (holC)
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: CBJ13064
Pasteur: llo2636
UniProt: D3HKU8
LinkDB
Position
3100414..3100848
AA seq 144 aa
MQPIRIDFYLLTNEQHNARWLLACRLLEKAYVKGHKVYVLCANKQDAEFLDELLWTFKED
SFIPHHLQGEGPEPPPPIQIGYEREPRGFNDILLNLSNNIPSFYSKFKRIMEIVLNSEAE
KEQSRAHYRSYKANGCELFTHLMK
NT seq 435 nt   +upstreamnt  +downstreamnt
atgcagccaattcgcattgatttttacctgttaaccaacgagcagcataatgctcgttgg
ttactcgcatgtcgcctcttagaaaaagcctatgttaaaggacataaggtttatgtcttg
tgcgctaataaacaagatgctgaatttcttgatgagctcttatggactttcaaagaagac
agctttattcctcatcatctgcaaggcgaggggcccgaaccgccccccccaatacagatt
ggatatgagcgggaaccaaggggatttaatgatattttattgaacctttcaaataatatc
ccctcattttactctaagtttaagcgtatcatggaaatagtactaaatagtgaggcagaa
aaagaacaaagccgtgctcattatagaagttataaagccaatggatgtgaattatttaca
catctaatgaaatag

DBGET integrated database retrieval system