KEGG   Lactococcus lactis subsp. cremoris A76: llh_1985Help
Entry
llh_1985          CDS       T01965                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Brite
KEGG Orthology (KO) [BR:llr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    llh_1985
Enzymes [BR:llr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     llh_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 HI0933_like FAD_binding_2 DAO Thi4 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 K_oxygenase Lycopene_cycl Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AEU39573
UniProt: G8P5E2
LinkDB All DBs
Position
375763..377289
Genome map
AA seq 508 aa AA seqDB search
MILDENLRSQLLPYMDLLENPIILKVDANDSENGQKINEFTDELASLSDLISKEKTNLNH
KPAFSIEREGVSGVAFSGLPLGHELNSLVLALVQVSGRPPRIEQELIEQIKAIKTSLHFD
TYVSLTCHNCPDVVQALNTMTILNPNISHTMIEGGMFQAEVEAKGIMAVPAVFKNAEEFH
SGRASLEELLEKITGPESSDSFAEKEPYDVLVVGGGPAGASAAIYAARKGIRTGLIAERF
GGQPLETLGIENLIGTPYIEGVQLGRQLEEHVKKYPVDLMNLQKAVKLEKKDLIEVSLEN
GATLKSKAVILSTGARWRDLGIPGEQRFKNKGVAYCPHCDGPLFSGKDVAVIGGGNSGIE
AAIDLAGLVNHVTVLEFLPELKADKILQKKLASLTNVTVLTNVETKEILGDEQVTGLNYQ
VRGYKETIHLELAGVFVLIGLVPNTQWLEGTIDLTDRHEIVTDKVGATNIPGVFAAGDCT
DTVYKQIIVSMGSGATASLGAFDYLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgaaaatctgcgttctcagttactgccgtatatggatttattagaaaat
ccaattattttaaaagtggacgcaaacgatagtgaaaatggacaaaaaataaatgaattt
acagatgaactggcaagtttatcagacttgatttcaaaagagaaaacaaatctgaatcat
aaaccggctttttcaattgaaagagaaggtgtttcaggggttgctttttcaggtcttcct
ttgggtcatgagttaaattcattggttttggcccttgtgcaagtgagtggtcgaccacca
cgtattgaacaagaattaattgaacaaattaaggctattaaaacttcacttcattttgat
acttatgtcagtttaacttgtcataattgtccagatgtggttcaagctttaaatacaatg
accattctcaaccctaacattagtcataccatgattgagggaggcatgttccaagcagaa
gtagaagcaaaaggaattatggctgttcctgctgtctttaaaaatgccgaagaatttcat
agtggacgagcaagtcttgaagaattgttggaaaaaattacaggtccagaaagttcggat
agtttcgcagaaaaagaaccttatgatgttttggtagtaggaggggggccagctggtgcg
agtgcagctatttatgcggcacgtaagggaatcaggacaggattgattgccgagcgcttt
ggaggccaacctttagaaactttagggattgaaaatctgattggaacaccctatatagag
ggtgttcagcttgggcgtcagcttgaagaacacgtaaaaaaatatccagtagatttgatg
aatctgcaaaaagcagttaaacttgagaaaaaagatttaattgaagtaagtcttgaaaat
ggtgcaaccttgaagagtaaagctgttattctctcaactggcgctcgttggcgggattta
ggaatcccaggagaacaacgctttaagaataaaggagtggcttattgtcctcattgtgat
ggtccgcttttctctggtaaagatgtggcagttattggtggaggaaattcagggattgaa
gcagcgatagacttagctggtttggtcaaccatgtcactgttcttgaatttttaccagaa
cttaaagcagataaaatcttacaaaaaaaacttgctagtctaactaatgttactgttttg
accaatgtggaaactaaagagattttaggagatgagcaagtcacggggttgaattatcaa
gttcgaggctataaagaaacgattcatttagagcttgccggtgtctttgttttgattggt
ttagttcccaatactcagtggttggaagggacaattgatttgacagatcgtcatgaaatt
gtgactgataaggttggagcaacaaatattccgggtgtctttgcagcaggagattgcaca
gatactgtttataaacaaattattgtgtcaatgggaagtggagcgactgcttccttaggt
gcctttgattatttgataagaaattaa

DBGET integrated database retrieval system