KEGG   Lysobacter maris: C9I47_2410Help
Entry
C9I47_2410        CDS       T05495                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lmb  Lysobacter maris
Brite
KEGG Orthology (KO) [BR:lmb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C9I47_2410
Enzymes [BR:lmb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C9I47_2410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored DAO AlaDh_PNT_C Glutaredoxin FAD_binding_3 NAD_binding_7 HI0933_like K_oxygenase Thi4 FMO-like NAD_binding_8 DUF2703
Motif
Other DBs
NCBI-ProteinID: AWV08088
UniProt: A0A2U9TC04
LinkDB All DBs
Position
2953781..2955403
Genome map
AA seq 540 aa AA seqDB search
MLDAALKTQLKAYLEKVTHPIELVASLDDGAKSQELDALLRDIAGLSDKVTCSRADDDAR
RPSFAIRRAGTDIEVRFAGLPMGHEFTSLVLALLQVGGHPPKLSDEIVAQIRAIEGEFQF
ETYFSLSCQNCPDTVQALNAISVINPRIRHVSIDGALFQDEVEARQIMSVPTVLLNGEPF
DQGRMTVEQILAKIDTGAAARAAEQIKAKDAFDVLVIGGGPAGAAAAVYAARKGIRTGVA
AERFGGQVLDTMAIENFISVPYTEGPKLAAALEQHVREYDVDVMNLQRATALVPATEPGG
LIEVRLAGADGEPGPSLKSRSVVLSTGARWRQMGVPGEDQYRNKGVAYCPHCDGPLFKGK
RVAVIGGGNSGVEAAIDLAGIVAHVTLIEFDAKLRADEVLQRKLRSLPNVEVIVSAQTTE
VLGDGQKVSGLSYKDRDSGDLNRLELEGVFVQIGLLPNTEWLKGTLELSPRGEIVIDERG
QTSVPGVFAAGDATTVPYKQIVIAMGAGSTAALSAFDHLIRSSAPVESAATQALTEAAVA
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccgcactcaagacccagttgaaggcttacctcgagaaggtcacccacccg
atcgagctggtcgcctcgctcgacgacggcgccaaatcgcaggaactcgacgcgctgctg
cgcgacatcgccggactgtctgacaaggtcacctgctcgcgcgccgacgacgacgcacgc
cgcccctcgttcgcgatccgccgcgccggcaccgacatcgaagtccgcttcgccggcctg
ccgatgggccacgagttcacctcgctggtgctggcgctgctgcaggttggcggccatccg
ccgaagctgtcggacgagatcgtcgcgcagatccgcgcgatcgagggagagttccagttc
gagacctatttctcgctgtcctgccagaactgcccggacaccgttcaggcgctgaacgcg
atcagcgtgatcaaccccaggatccggcacgtctcgatcgacggtgcgctgttccaggac
gaggtcgaggcccgccagatcatgtcggtgccgaccgtgctgctcaacggcgagcccttc
gaccagggccggatgacggtcgagcagatcctcgcgaagatcgacaccggcgccgccgcc
cgcgccgccgagcagatcaaggccaaggacgccttcgacgtgctggtgatcggtggcggc
cccgcaggcgccgcggccgcggtctacgccgcccgcaagggcatccgcaccggcgtcgcc
gccgagcgcttcggcggccaggtgctggacacgatggcgatcgagaacttcatctcggtg
ccgtacaccgagggtcccaagctcgccgccgcgctggagcagcacgtgcgcgagtacgat
gtcgatgtgatgaacctgcagcgcgcgaccgcgctggtgccggcgacggaaccgggcggc
ctgatcgaagtgcgactggccggcgccgatggcgaaccgggcccgtcgctgaagtcgcgc
tcggtggtcctgtccaccggcgcgcgctggcggcagatgggcgtgcccggcgaggaccag
taccgcaacaagggcgtggcgtactgcccgcactgcgacggccccctgttcaagggcaag
cgggtcgcggtgatcggcggcggcaattccggcgtcgaggccgcgatcgacctcgccggc
atcgtcgcccatgtcaccctgatcgagttcgacgcgaagctgcgcgccgacgaggtcctg
cagcgcaagctgcgcagcctgccgaacgtcgaggtgatcgtcagcgcgcagaccaccgag
gtcctcggcgacggccagaaggtatccggcctgagctacaaggaccgcgacagcggcgac
ctgaaccggctggagctggaaggcgtgttcgtgcagatcggcctgctgcccaacaccgag
tggctgaagggcacgctggaactgtcgccgcgcggcgagatcgtgatcgacgaacgcggc
cagaccagcgtcccgggcgtgttcgccgccggcgatgccaccacggtgccgtacaagcag
atcgtgatcgcgatgggcgccggctcgaccgcggcgctgagcgccttcgaccacctgatc
cgcagctcggcgccggtcgaatccgcggcgacgcaggcgctgaccgaagccgccgttgca
tga

DBGET integrated database retrieval system