KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1495
Entry
LEUM_1495         CDS       T00411                                 

Definition
(GenBank) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
lme00550  Peptidoglycan biosynthesis
lme01100  Metabolic pathways
lme01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LEUM_1495
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LEUM_1495
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lme01011]
    LEUM_1495
Enzymes [BR:lme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     LEUM_1495
Peptidoglycan biosynthesis and degradation proteins [BR:lme01011]
 Precursor biosynthesis
  Glycosyltransferase
   LEUM_1495
SSDB
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C Glyco_trans_1_4 UDPGT Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_4_2 Glycos_transf_1 Glyco_trans_1_3 Abhydrolase_9
Other DBs
NCBI-ProteinID: ABJ62587
UniProt: Q03W35
LinkDB
Position
complement(1493844..1494935)
AA seq 363 aa
MKIILSGGGTGGHIYPALALAEVIRKHEPDTEFLYVGSERGVESNIVPATGMPFEKLTVQ
GFKRSFSLENIKTVSLFLKAVKEAKKIIKDFDPDVVVGTGGYVSGAVVYAAQRLHIPTVI
HEQNSVAGVTNKFLSRGATKIGVAFDAALSQFPKDKVFVVGNPRAQQVASIKSNFSWQQI
GLSDEKPSLLIFGGSQGAPPINLAVIDAMQEFNKRNYQVVIVTGPKRYENVLDRLTTQPA
DNVRILPYIENMPEVLAKTSAIVSRAGATSIAEITALGIPSILVPSPYVTGDHQTKNAQS
LVDAGAALMITEPALSGKALLLAADSLLLNESVSKTMTEQAKNVGIRDAGDRLYALILDA
IGE
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgaaaataattctatcgggtggtggtactggtggtcacatttacccagcattggcacta
gctgaagtcattcgtaaacatgagccggatacggaatttttgtatgttggttcagaacgt
ggtgtggaatcaaacattgtgccggccacaggcatgccttttgaaaaattaactgttcaa
ggctttaaaagatctttttcattagaaaatatcaagacagtatcattattcttaaaagcg
gttaaagaggctaaaaagattattaaggattttgatcctgatgttgtagttggaacaggt
ggatatgtcagtggcgctgttgtctatgctgcccaaaggctgcacatcccaactgttata
catgagcaaaattcagtggcaggcgttacaaataagtttttgtcacgtggtgcaactaag
ataggtgtcgcttttgatgctgcgctgtcacaatttcctaaagacaaagtatttgttgta
ggaaacccgcgggcccaacaggtggcatctattaagtctaatttttcatggcaacaaatt
ggattgagcgatgaaaagccatcattattgatatttggaggctctcaaggggcaccgcca
atcaatttagctgtcattgatgctatgcaagagtttaataaaagaaattatcaagtcgtt
attgtgactggtccaaagcgatatgaaaatgttttagatcggctgactacacagccagca
gataatgttcgaattttaccttacattgaaaacatgccagaggtattggcaaaaacgtcg
gctattgtatctcgagctggtgcaacgtctattgctgaaatcacggcactgggcattcca
tcaattctagtgccaagcccctatgttactggtgaccatcaaacaaaaaatgcacaaagc
ctagttgatgcaggcgctgcattgatgattactgaaccagctttgtcagggaaagcatta
ttgctagcagcggattcgctgttattaaatgaatctgttagcaaaacaatgacagaacaa
gctaaaaatgttggcatcagagatgctggagatcgtttatacgcgttaatattagatgca
attggtgaataa

DBGET integrated database retrieval system