KEGG   Listeria monocytogenes J0161: LMOG_01840Help
Entry
LMOG_01840        CDS       T01987                                 

Definition
(GenBank) galactitol-specific PTS system IIA component
  KO
K02773  galactitol PTS system EIIA component [EC:2.7.1.200]
Organism
lmj  Listeria monocytogenes J0161
Pathway
lmj00052  Galactose metabolism
lmj01100  Metabolic pathways
lmj02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LMOG_01840
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    LMOG_01840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lmj02000]
    LMOG_01840
Enzymes [BR:lmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.200  protein-Npi-phosphohistidine---galactitol phosphotransferase
     LMOG_01840
Transporters [BR:lmj02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Galactitol-specific II component
    LMOG_01840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_2
Motif
Other DBs
NCBI-ProteinID: AEO04831
LinkDB All DBs
Position
complement(2798230..2798694)
Genome map
AA seq 154 aa AA seqDB search
MDLVQFLKKGMVWVQSDIEKQEDLFQMVAESGKSEGYVTDDFLTRLTDREQTFPTGLKLD
GYGVALPHTDPECVTEQFIAVITVKDGIPFKLMEDAGQTVEANLIFVLGLNEPHSQLAVL
QQLMGTIQDKDNVAALLRAKDEDEVKQILETIAV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggatttagtacaatttttgaaaaaaggaatggtttgggttcaatcggatatcgagaaa
caagaggacctattccaaatggtcgcagaaagtgggaagtctgaagggtatgttacggat
gactttttaacgagactaacagaccgtgaacaaacctttccaacggggctaaaattagat
ggatacggcgtggcattaccgcacacggatccagaatgcgttacggaacaatttatcgcc
gtaatcactgtgaaagatggcattccatttaaattaatggaagatgctggtcaaacggtt
gaagcgaatttgattttcgtactcggactaaatgaacctcacagccagctcgcggtactt
cagcaattgatggggacgattcaagataaagacaatgtagccgcattactcagagcgaaa
gatgaagacgaagtaaaacaaattttagaaacaatagccgtttaa

DBGET integrated database retrieval system