Leuconostoc mesenteroides KFRI-MG: LMES_1449 Help Entry LMES_1449         CDS       T02997                                  Name (GenBank) SSB-like protein   KO K03111   single-strand DNA-binding protein Organism lmk  Leuconostoc mesenteroides KFRI-MG Pathway lmk03030   DNA replication lmk03430   Mismatch repair lmk03440   Homologous recombination Brite KEGG Orthology (KO) [BR:lmk00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     LMES_1449    03430 Mismatch repair     LMES_1449    03440 Homologous recombination     LMES_1449  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lmk03032]     LMES_1449    03400 DNA repair and recombination proteins [BR:lmk03400]     LMES_1449    03029 Mitochondrial biogenesis [BR:lmk03029]     LMES_1449 DNA replication proteins [BR:lmk03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     LMES_1449 DNA repair and recombination proteins [BR:lmk03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      LMES_1449   TLS (translesion DNA synthesis) factors    Other SOS response factors     LMES_1449 Mitochondrial biogenesis [BR:lmk03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     LMES_1449 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB Motif Other DBs NCBI-ProteinID:  AHF19665 LinkDB All DBs Position complement(1512604..1513029) Genome browser AA seq 141 aa AA seqDB search MNQVNLTGRLTKDIELRYTQSGKAVGSGTVAVNRRFKQQDGPTADFINFTMWGKAAENFS NFTHKGSLVGLGGEWQTRNYENNAGQRVYVNELNANTFDLLEPRGEQPQSSQSNNVNVAD VNPFASKGNSPIDISDDDLPF NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgaatcaagtgaacctaacgggacgactaactaaagatattgaactacgttacacacaa tcaggcaaagcagttggaagtggaacggtagctgttaatcgtcgatttaaacagcaagat ggcccgacagcggactttatcaatttcaccatgtggggtaaagcggcagaaaacttttca aacttcacacacaaaggctctctagttggtttgggtggtgaatggcagacacgtaactat gaaaataatgccggtcagcgagtttatgtaaacgaactcaacgctaatacttttgaccta ttagagccaagaggcgaacagccacaatctagtcaatcaaacaatgtgaatgttgctgat gttaatcccttcgcctctaaaggaaacagtccaatagacatcagtgacgatgatttacca ttctaa

DBGET integrated database retrieval system