KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo2663Help
Entry
lmo2663           CDS       T00066                                 

Definition
(RefSeq) polyol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Pathway
lmo00040  Pentose and glucuronate interconversions
lmo00051  Fructose and mannose metabolism
lmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    lmo2663
   00051 Fructose and mannose metabolism
    lmo2663
Enzymes [BR:lmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     lmo2663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 984376
NCBI-ProteinID: NP_466185
Pasteur: LMO02663
UniProt: Q8Y414
LinkDB All DBs
Position
complement(2736597..2737628)
Genome map
AA seq 343 aa AA seqDB search
MKAVVKTNPGYDQMELKDVEEPQVYGDKVKIKVAFTGICGSDIHTFKGEYKNPTTPVTLG
HEFSGVVVEVGPDVTSIKVGDRVTSETTFETCGECIYCKEHDYNLCSNRRGIGTQANGSF
AEFVLSREESCHVLDERISLEAAALTEPLACCVHSALEKTTIRPDDTVLVFGPGPIGLLL
AQVVKAQGATVIMAGITKDSDRLRLAKELGMDRIVDTLKEDLAEVVLGMTGGYGAERVFD
CSGAVPAVNQGLPLTKKKGDFVQVGLFAEKKNAIDEESIIQREIAYIGSRSQKPSSWILA
LDLLANGKIDTDKMITKVYGLDDWREAFEAVMAGNEIKVLVKS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcagtagtaaaaacaaatcccggatatgatcaaatggagctaaaagatgtggaa
gaaccacaagtctatggcgacaaagtaaaaatcaaagtagcattcactggtatttgcgga
tcagatatccatacgtttaaaggagaatacaaaaatccaacaactcccgtcacacttgga
catgaattttctggtgtcgttgtagaagttgggccagatgtaacgagtatcaaagtggga
gaccgtgtcacaagtgaaacaacttttgaaacttgtggagagtgtatttattgtaaagaa
catgattacaatttatgtagcaatcgtcgcggcattggtacgcaagcaaatggtagtttt
gcagaatttgttttatctcgcgaggaaagttgccacgtgctagatgaacgtatttcgctc
gaagcagcagcactgacagaaccacttgcatgttgcgtgcattcggcgcttgaaaaaaca
acaattcgtccagatgacacagtacttgttttcggaccggggccaattggattattacta
gctcaagttgtgaaagcgcaaggggcaacggtgattatggcaggaattaccaaagatagc
gaccgcttacgtctagcaaaagaacttggaatggaccggattgtcgataccttaaaagaa
gacttggctgaagttgtgctcggcatgacagggggttacggagcggaacgcgtatttgat
tgctcaggcgcagtaccagctgtaaatcaaggattacctctaacgaagaaaaaaggcgat
tttgttcaagtaggactttttgccgaaaagaaaaatgcgattgatgaagaatctattatc
caacgtgaaattgcttatattggcagccgttctcaaaaaccatcttcttggattttagca
ctcgacttacttgctaatggcaaaatcgatacagataaaatgattaccaaagtatatggt
ttagatgactggcgcgaggctttcgaggcagttatggcaggtaatgaaattaaagtatta
gtgaaatcttaa

DBGET integrated database retrieval system