KEGG   Listeria monocytogenes serotype 4b LL195: BN389_14880
Entry
BN389_14880       CDS       T02416                                 

Gene name
era
Definition
(GenBank) GTPase Era
  KO
K03595  GTPase
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Brite
KEGG Orthology (KO) [BR:lmog00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lmog03009]
    BN389_14880 (era)
   03029 Mitochondrial biogenesis [BR:lmog03029]
    BN389_14880 (era)
Ribosome biogenesis [BR:lmog03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   BN389_14880 (era)
 Prokaryotic type
  GTPases
   BN389_14880 (era)
Mitochondrial biogenesis [BR:lmog03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN389_14880 (era)
SSDB
Motif
Pfam: MMR_HSR1 KH_2 FeoB_N GTP_EFTU Dynamin_N RsgA_GTPase AIG1 cobW PduV-EutP MMR_HSR1_Xtn SRPRB ABC_tran Ras SRP54 KH_4 Roc KH_1 AAA_22 RNA_helicase
Other DBs
NCBI-ProteinID: CCO64062
UniProt: A0A0E1R5U6
LinkDB
Position
complement(1475597..1476610)
AA seq 337 aa
MLCARYASNINKLNRENSDGNGERTFTRRIHIGGYVMSEPFKSGFVAIVGRPNVGKSTLL
NHIIGQKIAIMSDKAQTTRNKVQGVYTTDESQIIFIDTPGIHKPKHKLGDFMVKIALNTF
QEVDLIYFVIDASTGFGRGDEFIIEKLKNVQTPVFLLINKIDLIAPEDLFKLIEQYRDLM
DFDEIIPISALQGNNVPNLLEQTNANLEIGPMYYPKDQITDHPERFIISELIREQVLQLT
REEVPHSVAVVIEGIEKNPKTEKLTINATIIVERSTQKGIIIGKQGQMLKQIGMRARKEI
ERLLGSKVFLEIWVKVQKNWRDKEHYLQDYGFDREEY
NT seq 1014 nt   +upstreamnt  +downstreamnt
attttgtgcgccagatatgccagtaatattaacaaacttaacagggaaaacagcgacggt
aacggtgaaagaacttttaccaggcgcattcacatcggaggatatgttatgagtgaacca
tttaaatcaggatttgtagctatagttgggcggcctaacgttgggaaatcaactttatta
aatcacatcattggccaaaaaattgccattatgagtgataaagctcaaacaacaagaaat
aaagtacaaggtgtttatacaacagatgaatcacaaattatttttattgatacaccaggt
atacataaaccaaagcataaattaggcgatttcatggtgaagattgcgctaaatacgttc
caagaagtagacttaatttatttcgtaatcgacgcatctaccggatttggacgcggagat
gaatttattattgaaaaacttaaaaacgtacaaacacctgtttttcttttgattaataag
attgatttaattgctccagaagatttattcaagttaattgaacagtaccgcgatttgatg
gactttgatgagattattcctatttcagcacttcaaggaaataacgtgcctaacttacta
gaacaaacgaatgctaacttagaaatcggaccaatgtattatccaaaagatcaaatcacg
gaccatcctgagcgtttcatcatctcggagttaattcgtgaacaggttttacaattaaca
cgagaagaagttccacattctgtagcagtggttattgaaggaattgaaaaaaaccctaaa
acagaaaaacttacaatcaatgctacaattattgtagaaagaagcacgcaaaaaggaatt
attattggtaaacaaggtcaaatgctaaaacaaattggtatgcgtgctagaaaagaaatt
gaacgcttactcggctccaaagtcttcttagaaatttgggtaaaagttcaaaaaaactgg
cgcgataaagagcattatttgcaagattacggtttcgaccgcgaagagtattaa

DBGET integrated database retrieval system