KEGG   Listeria monocytogenes serotype 4b LL195: BN389_16880
Entry
BN389_16880       CDS       T02416                                 

Gene name
leuS
Definition
(GenBank) Leucine--tRNA ligase
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
lmog00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lmog00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN389_16880 (leuS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lmog01007]
    BN389_16880 (leuS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lmog03016]
    BN389_16880 (leuS)
   03029 Mitochondrial biogenesis [BR:lmog03029]
    BN389_16880 (leuS)
Enzymes [BR:lmog01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     BN389_16880 (leuS)
Amino acid related enzymes [BR:lmog01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BN389_16880 (leuS)
Transfer RNA biogenesis [BR:lmog03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BN389_16880 (leuS)
 Prokaryotic type
    BN389_16880 (leuS)
Mitochondrial biogenesis [BR:lmog03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN389_16880 (leuS)
SSDB
Motif
Pfam: tRNA-synt_1 tRNA-synt_1_2 tRNA-synt_1g Anticodon_1 tRNA-synt_1e tRNA-synt_1f
Other DBs
NCBI-ProteinID: CCO64262
UniProt: A0A0E1R6D6
LinkDB
Position
complement(1689772..1692324)
AA seq 850 aa
MDKLSGQTLMWVVPREKHLSSHGDKPLGCRDFFVAKIRYFKEKRMSKVTFNHKKMEPKWQ
QYWSEHNTFKTTEDKNKDNFYALDMFPYPSGAGLHVGHPEGYTATDILSRMKRMQGKNVL
HPIGWDAFGLPAEQYAIDTGNDPEEFTALNIANFTRQIKSLGFSYDWDREINTTDPEYYK
WTQWIFEKLYEKGLAYEAEIAVNWCPALGTVLANEEVIDGKSERGGFPVFRKPMRQWMLK
ITAYADRLLDDLDLVDWPENIKDMQRNWIGRSEGAEVTFKIKDSDETFNVFTTRPDTLFG
ATYTVFAPEHELIEKITTPEQKEAVEAYKKQVELKSELERTDLAKDKTGVFTGAYAINPI
NGEEVPIWIADYVLIQYGTGAIMAVPAHDERDFEFAQQFGLNIRPVLEGGDVTKEAFTGD
GPHINSDFLNGLAKAEAITAAIDWLEKEGIGSRKITYRLRDWLFSRQRYWGEPIPVIHWE
DGETTLVPEDELPLLLPKATEIKPSGTGESPLANLHDWVNVTDKNGRKGRRETNTMPQWA
GSSWYFLRYIDPNNSEAIADKEKLAEWLPVDVYIGGAEHAVLHLLYARFWHKFLYDIGVV
PTKEPFQKLFNQGMILGENNEKMSKSRGNVVNPDEVVEKYGADTLRLYEMFMGPLEASIA
WNENGLEGARKFLDRIWRLLVTEEGTLAEKVTTDANANLEKAYHHMVKTVTNHYENLRFN
TGISQLMIFINEAYKQDTIPKQYVEGFVQLLSPIAPHLAEELWEILGHTETISYVAWPTY
DETKLVEDEVEIVLQVNGKVKSKITVAKSLEKEELEKIAQEDNKMKENLEGKTIRKVIVV
PGKLVNIVAN
NT seq 2553 nt   +upstreamnt  +downstreamnt
attgataagttgagtggtcaaacactaatgtgggtggtaccgcgggagaagcatctctcg
tcccatggcgataagccgttgggatgtagggatttttttgtagccaaaattcgatatttt
aaggaaaagaggatgagtaaagtgacatttaatcacaaaaaaatggaaccaaaatggcaa
caatattggagtgaacataacactttcaaaacaacagaagataaaaataaagataacttc
tatgcactagatatgttcccttacccatctggagcaggtcttcacgtaggacatccagaa
ggttatacagcaacagatattttgtctcgtatgaaacgaatgcaagggaagaacgtcctt
catccaatcggttgggatgcttttggtcttcctgcagagcaatatgcaattgatactggt
aacgacccagaagaatttaccgcactgaatattgccaactttactcgccaaattaaatca
cttggtttttcctacgactgggaccgtgaaatcaatacaacagatcctgaatattataaa
tggacacagtggatttttgaaaaactatatgaaaaaggtttagcttatgaagccgaaatc
gctgtaaactggtgtccggcacttggtactgttttagccaatgaagaagttatcgatggc
aaaagtgaacgcggtggcttcccagttttccgcaaaccaatgcgtcaatggatgcttaaa
attaccgcgtacgcagatcgtttgctagatgatcttgatctagtggattggcctgaaaat
attaaagatatgcaacgtaactggattggtcgttcagaaggcgcagaagttacttttaaa
attaaagatagcgatgaaacgtttaatgttttcacaacacgtccagatacactttttggc
gcaacatataccgtttttgcaccagaacacgaacttatcgaaaaaatcacaacaccagaa
caaaaagaagcagttgaagcttataaaaaacaagtagaacttaaaagcgaactggaaaga
accgaccttgcaaaagataaaacaggtgtcttcacaggagcatatgcgattaatccaatc
aacggtgaagaagtgccaatttggattgcggactacgtgttgattcaatatggaacaggt
gcaattatggccgtaccagcccacgatgaacgcgactttgaatttgcgcaacaatttggt
ttgaatattcgtcctgttcttgaaggcggcgacgtgacaaaagaagcattcactggcgac
ggaccacatattaactctgatttcttgaacggactagctaaagccgaagcgattaccgct
gcgattgattggctagaaaaagaaggcattggtagccgtaaaatcacgtatcgtttgcgc
gactggttgttcagcagacaacgttactggggtgaaccaattccagttattcactgggaa
gacggggaaacaacgcttgtaccagaagacgaactaccactacttctgccaaaagcaaca
gaaatcaaaccatcaggaacaggcgaatcaccacttgctaacttgcatgactgggtaaac
gtaacagacaaaaacggtcgaaaaggtcgtcgcgaaacaaatacaatgccacaatgggct
ggctcaagctggtatttcttgcgttatatcgatccaaataacagcgaagcaattgctgac
aaagaaaaactagcagaatggcttccagttgacgtttatatcggcggggcagagcatgca
gtgcttcaccttctttacgcacgtttctggcataaattcttgtacgatatcggtgtagtt
ccaacaaaagaacctttccaaaaactatttaaccaaggtatgattcttggcgaaaataac
gaaaaaatgtccaaatcaagaggtaatgttgttaaccctgatgaagtagtagaaaaatac
ggcgcagacacacttcgcttgtacgaaatgttcatgggaccactagaagcttcgattgca
tggaacgaaaatggactggaaggtgcacgtaaattcctagaccgcatctggcgcttgcta
gtaactgaagaaggcacactcgctgaaaaagtgacaactgatgcgaatgctaacttagaa
aaagcatatcatcatatggtgaaaacagttaccaaccattacgaaaacctgcgtttcaat
accgggatttcgcaactgatgattttcatcaatgaagcatataaacaagatacgattcca
aaacaatatgtcgaaggtttcgttcaactcttgtcaccaatcgcaccacaccttgcagaa
gaattgtgggaaatcctaggtcacaccgaaacaatcagctacgtagcttggccaacatac
gacgaaacaaaactagtagaagatgaagtagaaatcgtacttcaagtaaacggcaaagta
aaaagcaaaatcaccgttgccaaatctctcgaaaaagaagaattagaaaaaattgcacaa
gaagacaacaaaatgaaagaaaacctagaaggcaaaacaatccgtaaagtgattgtcgtt
ccagggaaacttgtaaatattgttgcgaactaa

DBGET integrated database retrieval system