KEGG   Listeria monocytogenes 10403S (serotype 1/2a): LMRG_02958Help
Entry
LMRG_02958        CDS       T01984                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
lmt  Listeria monocytogenes 10403S (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmt00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    LMRG_02958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB Pex24p
Motif
Other DBs
NCBI-ProteinID: AEO06690
UniProt: A0A0H3GKU3
LinkDB All DBs
Position
complement(1727090..1727959)
Genome map
AA seq 289 aa AA seqDB search
MWKKVVKYVKQNGIVQVGQAVSARVGRNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYLH
IDKDSVFNMIKEFAPDQIMDFLEENLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKSL
NKAYGVTNKRNYVVQRLLSMFFTLAMLATVGATLLLLVFGQQIGMFLINHLNFSEDFLSF
WNNLRWTVTLIVIFVVFTFLYWVAPNRRSTLISVLPGALFSTIGWTVASLGFAYYVNNFG
NYSATYGSIGVIIILMLWFYLTGIILMIGGELNATLAIRKKKKELGEIN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgtggaaaaaagtagtaaaatatgttaaacaaaacgggattgttcaagtcggccaagca
gtaagtgctagagtagggcgaaatgatgtttctggaaatgcagcacagttagcttattat
atgctgttttccatttttccaatgctcttaattgcagcaacattacttgcttatcttcat
attgataaagattctgtttttaatatgattaaagaattcgcgccagaccagattatggac
tttttagaagaaaatttaaataacttattaacgcagaaaaatggcggattgctttctatc
gggattatcgcgactttatggtcggcatctaatggcatgaacgcggtcatgaaatcgctc
aataaagcgtatggcgtaaccaataagcgaaattacgtcgtacaacgattattatcaatg
tttttcacactcgcaatgcttgcaacagttggggcgaccttgttgttacttgtatttggt
caacaaattgggatgtttttaattaatcatttgaatttctcggaggactttcttagcttt
tggaataatcttcgttggacggttacactcattgttatctttgttgtctttaccttttta
tattgggtcgcaccaaaccgtcgcagtacgttgattagtgttctacctggagctttattt
tcaacaatcggttggacagttgcttcgctaggttttgcgtattacgtaaataatttcggc
aactattcggcaacgtatggcagtatcggtgtaattattattttaatgttatggttttat
ttgaccggtattattttgatgattggcggggagcttaacgctacactggcgattcggaaa
aagaaaaaagaattaggcgaaatcaattga

DBGET integrated database retrieval system