KEGG   Lactobacillus mucosae: LBLM1_03825
Entry
LBLM1_03825       CDS       T03814                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00010  Glycolysis / Gluconeogenesis
lmu00020  Citrate cycle (TCA cycle)
lmu00620  Pyruvate metabolism
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
lmu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBLM1_03825
   00020 Citrate cycle (TCA cycle)
    LBLM1_03825
   00620 Pyruvate metabolism
    LBLM1_03825
Enzymes [BR:lmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     LBLM1_03825
SSDB
Motif
Pfam: PEPCK_ATP AAA_29 AAA_23 AAA_33 ABC_tran
Other DBs
NCBI-ProteinID: AJT50273
UniProt: A0A0D4CJG5
LinkDB
Position
complement(758309..759955)
AA seq 548 aa
MSTQTKFSEKDIVKTNPIFSRTRTTIESAFYANNMTHIADTATAYRLAAGNPNTIVTDLP
IKHTEELGLPADAKMLVDNHGQIVGRTAAARRLIGSPDVDAEKIDGVLREAIYEGHERDF
YTTDVIVGLDEDFMVKAHLALAEGFEVNLLSYMLNFQTATENWLKRYADSRAYDEGDIYL
YCDPYWSSPDYPHGLVVIDAQHNAAAVLGLRYFGELKKSTLTLAWATAHRHGFTACHGGE
KTFHFSDRDDQTFAFYGLSGSGKSTLTHAKHGGKFDITVLHDDAFVINREDGSSTALEPA
YFDKTNDYLPGSREMQYFTTVMNVGVTLNEAGQKVLVTQDLRNGNGRTIKTRYASTNRVD
REIAPINAVFWIMKDDSLPPVVKLTDPVTAATFGLTLATKRSTAENVVGADRNALVIEPF
ADPFRAYPLSEDYQDFKALFEERHVDCYIVNTANFNGLDIPKELTLKALEDIAQNQAAFK
PFGELANMEYIAYDGYPVDFNDAEYVTKLKTRFEIRRDWVKNYEAQHTGEKLPAEILTSL
DNLINDLN
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgagtactcaaacaaaattttctgaaaaagacatcgttaagaccaatccgatcttctca
cggacgcggactacgattgaatcggcattctacgccaacaacatgacgcatattgctgat
accgcgactgcttatcgtttggcggccggcaaccccaacaccatcgttaccgacctgcca
atcaagcataccgaagaactgggactgccagccgatgccaagatgctggtcgacaaccat
ggtcagatcgtgggccggaccgcggcagcacggcgtttgatcggttctccagacgttgat
gccgaaaaaatcgatggcgtcctgcgtgaagctatctatgaaggccacgaacgcgacttt
tacacgacggacgtgatcgtggggctggatgaagactttatggtaaaggcgcatctggca
ctagcagaaggatttgaggttaatctgctttcttacatgctcaacttccaaacagctacc
gaaaactggctaaagcgctatgccgattcacgggcctatgatgaaggcgacatctatctg
tactgcgacccatactggagcagtcccgactatccacatgggctggttgtcatcgatgct
cagcacaatgcagcggcagtcttgggtctgcgctactttggcgagcttaagaagtccact
ttgacgctggcctgggcaaccgcgcaccggcatggttttactgcttgtcacggcggcgaa
aagactttccacttcagcgaccgtgatgatcagacttttgctttctacgggctttctggt
tcgggcaagtctacgctgacgcacgccaagcatggtggcaagtttgatattaccgtgctg
catgacgatgcgtttgtaatcaatcgtgaagacggcagctccacggctcttgaaccggcc
tactttgacaagaccaacgactatctgccgggcagccgcgaaatgcagtactttactacg
gtgatgaacgttggtgtcacgcttaacgaagccggccaaaaagtactggtaacccaggat
ctgcgcaacggcaatggacggaccattaagacgcgctatgcctctaccaaccgggtggat
cgcgaaattgccccaatcaatgccgtcttttggattatgaaagatgacagtctgccacca
gtcgttaaactgaccgatcccgttaccgcggctacgtttggcctgacgctggctaccaag
cgctccacagctgaaaacgtggtgggcgctgaccgcaacgctttggttatcgaaccattt
gccgacccattccgcgcctacccattaagcgaggactatcaagactttaaggcgctgttt
gaagaacgccacgttgactgctacatcgtcaataccgccaactttaacggcttggacatc
cctaaagaactgaccttgaaggctttggaagacattgcccaaaaccaggccgcctttaag
ccatttggcgagctggccaacatggaatacattgcttacgacggctatccagttgacttt
aatgatgctgaatacgtaaccaagctcaagacgcgttttgaaatccggcgcgactgggtt
aagaactatgaagctcagcacacgggcgaaaaactgccagctgaaattctgaccagtctg
gacaacttgatcaacgatctaaactaa

DBGET integrated database retrieval system