KEGG   Lactobacillus mucosae: LBLM1_09350
Entry
LBLM1_09350       CDS       T03814                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00020  Citrate cycle (TCA cycle)
lmu00620  Pyruvate metabolism
lmu01100  Metabolic pathways
lmu01120  Microbial metabolism in diverse environments
lmu01200  Carbon metabolism
lmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LBLM1_09350
   00620 Pyruvate metabolism
    LBLM1_09350
Enzymes [BR:lmu01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     LBLM1_09350
SSDB
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATP-grasp Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp_3 ATPgrasp_ST ATP-grasp_4 RnfC_N ATPgrasp_Ter HlyD_D23 RimK Oxidored_nitro GCV_H TipAS
Other DBs
NCBI-ProteinID: AJT51145
UniProt: A0A0D4CMK3
LinkDB
Position
complement(1998367..2001810)
AA seq 1147 aa
MKKVLIANRGEIAVRIIRACHELGLKTVAVYAKEDEYGVHRFRADEAYQIGAGKKPIEAY
LDMDDIIRVAKQTGADAVHPGYGFLAENEEFAQKCADNGIIFIGPTVRQLQLFGDKVAAK
EVAVKAGLKTIPGTDEPVQSIDEVREFAHTHGYPIMIKAAMGGGGRGMRIVHDDDELDGA
YDRARSEAKQSFGDDELYVEKYLKNPKHIEVQILADQHGHVMHLFERDCSVQRRNQKVIE
FAPSLALSEERRQAICQAAVKLMESVHYQNAGTVEFLVTDEDFYFIEVNPRIQVEHTVTE
LITDVDIVQSQILIADGADLYQDLELPAQDQLKYNGYGIQCRVTTEDPENNFMPDTGRIE
TYRSPGGMGVRLDGGNAYAGAVITPYFDSLLVKACVHGRTFKSAVRRMIRVLHEFQIRGI
KTNIPFMLNVLHHPVFAAGQAHTTFIDQTPELFDFKHEKPDAAKQLLTYVGDVTVNGFNG
VKAREQVHAAELKAPKINLERHNGLPIVNAKDILDRDGAEAAMKWVSAQKRVLITDTTMR
DAHQSLFATRMRTKDMLPIADLYDHAMPNVFSAEVWGGATFDVAYRFLGEDPWQRLKILR
EKMPHTMLQMLLRGSNAVGYKNYPDNVLKKFIDKSAEDGVDVFRIFDSLNWIEQMQKSIE
YVRQTGKIAEGTMCYTGDLLSPDEHKYTLDYYKTLAGQLVDAGAQIIGIKDMAGLLKPQA
AYELIGELKSKYDVPVHLHTHDTTGNGVATYVQATRAGVDVVDVASSALSGTTSQPSMSS
FYYALAGNERQPELDIETVEKINDYWAQVKPLYQDFMNGITSPQTDIYQTEMPGGQYSNL
QQQAKSLGLDDFDEVKAKYREVNALLGDIVKVTPSSKVVGDLAIFMIQNGLNAENIIERG
ETLDFPESVVNFFAGDLGQPYGGFPKQLQKVVLKDHPAITVRPGSLAQPVDFDQMTKELA
AQLKRQPTAEEVISYVLYPDVYLDYVKRNRQYGKIGVLDTNTFYQGMRPGEKIYVNLRPG
RTEILELNTVSDMDVDGNRHLLFSENGQQLVLTVKDQTHAATAKVSVPKADPHDPGQIGM
PLNGTVVDVMVENGQEVKKGQTLVVTEAMKMETTIKASFDGKIDKVYAKAGSTMESQDLL
IQMSPLS
NT seq 3444 nt   +upstreamnt  +downstreamnt
gtgaagaaagttttaattgccaatcgtggcgaaatagcagttcggatcattcgtgcctgt
catgagctgggcttgaagacggttgctgtttatgccaaggaagatgaatacggcgtccat
cgtttccgtgcggatgaggcctatcagattggtgcaggcaaaaagccaattgaggcttat
ctggatatggatgatattattcgagtcgctaagcagactggtgccgatgcagtccatcct
gggtacggttttttagcggaaaatgaagagtttgcgcaaaaatgtgcagacaacggcatt
atctttatcgggccaaccgttcgtcagctgcagctgtttggcgacaaggttgcggccaag
gaagttgcggtcaaggctggcttaaagacgattccaggtacggatgagccggttcagtca
attgatgaagttcgtgaattcgcgcatacgcatggctatccgatcatgatcaaggcagcc
atgggtggcggcggtcgtgggatgcgaatcgttcacgatgatgatgagcttgatggcgcc
tacgatcgagcccgcagcgaagccaagcagtcatttggtgatgatgagctttacgttgaa
aagtatctgaagaaccctaagcatattgaagtgcagattctagctgatcagcatgggcac
gttatgcacctgtttgagcgtgactgctcggttcagcgacggaatcaaaaagtgatcgag
tttgcgcctagtctggccttaagcgaagaacgacgtcaggcaatctgccaggcagccgtt
aagctgatggaaagcgtgcactatcaaaatgccggtacggttgaattcctggtcacggat
gaggacttttactttattgaggtcaacccgcggattcaagttgagcatactgttacagaa
ttgattaccgatgtcgacatcgtacagtcgcagattctgattgctgatggtgccgatctg
tatcaggatcttgagctgccggcccaggatcagctgaagtacaacggctatgggattcaa
tgccgagttacgactgaagatccagaaaacaactttatgccggatactggccgcatcgaa
acctatcgttcacctggtgggatgggcgtacggcttgatgggggcaatgcctatgctggg
gctgtaatcacgccatactttgattccttgctggttaaggcctgcgttcatggtcgaact
ttcaaatcagcggtccggcgtatgattcgagtgctgcatgagttccagattcgcggcatt
aagaccaacattccgttcatgctcaacgtcttgcatcatccagtctttgcggctggtcag
gcgcatacgacgtttattgatcagacgccagagctgttcgacttcaagcatgaaaagccg
gatgccgccaagcagctgctgacctatgttggtgacgttaccgttaacggctttaatggc
gtcaaggcacgcgaacaggttcatgctgctgaattaaaggcgccaaagatcaatcttgag
cgtcataatggactgccaatcgtcaatgccaaggatatcctggatcgtgacggagctgag
gcggcaatgaagtgggtcagcgcccaaaagcgggttctgatcactgatacgacgatgcgg
gacgctcaccagagtctgtttgccacgcggatgcggaccaaagacatgctgccgattgcg
gacctttacgatcacgccatgccaaacgtcttctcagctgaagtatggggcggggcaacc
tttgacgtggcctatcgtttcttaggcgaggatccatggcagcggctgaagattctgcgt
gaaaagatgccgcataccatgctgcagatgttattgcggggatcgaacgccgttggctac
aagaactatcctgacaacgtcttaaagaaattcatcgataagagtgctgaagatggcgtt
gacgtctttcggatctttgacagtctgaactggatcgaacaaatgcaaaagagcattgaa
tacgttcggcagactggcaagattgctgaagggacgatgtgctatacgggtgacctgctc
agcccagacgagcataaatacacgctggactactacaagacgctggctggtcagctggtt
gatgctggggctcagatcatcggtatcaaggatatggctggactgctcaagccacaggcc
gcctatgaactgattggcgaactgaagagcaagtatgacgtaccggttcacctgcatacg
catgacacgactggcaatggggttgcaacctacgttcaggctaccagagccggcgttgac
gtggttgacgtggcttccagcgcactttcgggaacgaccagtcagccaagcatgagcagt
ttctactatgctttagctggtaatgaacggcagccagaactggatattgaaacggtcgaa
aagatcaatgactactgggcacaggtcaagccgctataccaagacttcatgaacggcatt
acgtcaccacagaccgacatctatcaaacggagatgcctggtggtcagtactccaacctg
cagcagcaggctaagtcgctgggactggatgactttgacgaggtcaaggccaagtatcgt
gaggttaacgccctgcttggcgatatcgttaaggttacgccaagttctaaggtagtcggc
gatctggccatctttatgattcaaaacggcttgaatgccgaaaacattatcgaacgcggc
gaaacgctcgacttcccagaatccgtagtcaacttctttgcaggtgatcttggtcagcca
tatggcggctttccaaagcagctgcaaaaagtcgtcttaaaggatcacccagcgattacg
gttcgtcccggcagtctggcccagccagttgactttgatcagatgaccaaggaactggct
gcacagctgaaacgccagccaaccgctgaagaagtcatcagctatgtactgtacccagac
gtttatcttgattatgtcaagcgcaatcgtcaatatggcaagattggcgtcctggacacg
aatacgttctatcaaggaatgcgcccaggcgaaaagatctacgtcaatctgcggccgggt
cgtacggagattcttgagctcaatacggtttctgacatggacgttgacggcaaccgccac
ctgctgttctccgaaaacggtcagcagcttgtcttgacggtcaaggatcagacacacgca
gccacggccaaggtcagcgtgccaaaagccgatccgcacgatccaggtcagatcgggatg
ccgcttaatgggacggtcgttgacgtgatggtcgaaaatggtcaagaagtcaagaagggc
cagacactggtcgtaaccgaggccatgaagatggaaacgacgatcaaggcctcgtttgac
ggtaagattgataaagtctatgccaaggccggctcgacgatggaaagccaagacctgctg
attcaaatgagtcctttaagctaa

DBGET integrated database retrieval system