KEGG   Lelliottia nimipressuralis: CWR52_21005Help
Entry
CWR52_21005       CDS       T05333                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
lni  Lelliottia nimipressuralis
Pathway
lni00500  Starch and sucrose metabolism
lni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CWR52_21005
Enzymes [BR:lni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CWR52_21005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939 CdhD
Motif
Other DBs
NCBI-ProteinID: AVH19504
UniProt: A0A2L2JI62
LinkDB All DBs
Position
complement(4352068..4353555)
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQCFHWYYPAGGELWREVTALAPNLNEIGINMIWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSIATKYGDKAQLLEAIDALKRNDIAVLLDVVVNHKMGADEKEPVRVQRV
NAQDRTQIDDEVIECEAWTRYTFPARAGQYSQFIWDYKCFSGVDHIENPDEDGIFKIVND
YTGEGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTGCDGFRLDAVKHI
PAWFYKEWIEHVQEVADQPLFIVAEYWSHEVDKLQAYIDQVEGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLFGASYDDTGGDGETYHIDMPVIEQLHELILARQRFAHGVQTLFFDHPNCI
AFSRSGTEDDPGCVVVMSNGDDGEKVICLGENYGNKTWRDFLGNREETVTTAADGEGTFT
CKGGSVSVWVIEDAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccaccctgttacaatgttttcactggtactaccctgctggcggtgaattg
tggcgagaggtcacggcgttagcacccaatcttaacgaaatcggcattaacatgatctgg
ctaccgcccgcctataaaggcgcgtcaggcgggtattctgtcggctatgactcctatgac
ctgttcgatctgggcgagtttgaccagaaaggcagtatcgccaccaaatacggtgacaaa
gcgcagctgctggaggccatcgacgccctcaagcgcaacgacattgccgtgctgctggac
gtggtggtcaaccacaaaatgggcgccgatgaaaaagagccagtgcgcgtgcagcgcgtg
aacgcgcaggatcgcacgcaaatcgatgatgaggtcattgagtgtgaagcctggacccgc
tataccttccctgcccgcgccgggcaatattcccagttcatctgggactacaaatgcttc
agcggcgtcgaccacattgaaaaccccgatgaagacggcatttttaaaatcgtcaacgac
tacaccggcgaaggctggaacgatcaggttgatgatgagatgggtaacttcgactatctg
atgggcgaaaatatcgactttcgcaatcacgccgtcaccgaggagatcaaatactgggcc
cgatgggttatggaacagacgggctgcgacggttttcgtctggacgccgtcaagcatatt
cccgcctggttctacaaagagtggattgagcacgtccaggaggtcgccgaccagccgctg
tttatcgtggcggaatactggtcccatgaggtggataaacttcaggcctatatcgaccag
gttgaaggcaaaaccatgctgtttgatgccccgctgcagatgaaattccacgaggcgtcg
cgtcagggccgggattacgacatgagccaaatcttcaccggcacgctggtggaagccgat
ccgtttcatgcggtgactcttgtcgcgaaccatgacacccagcctttgcaggcgctggaa
gccccggtcgaagcctggtttaaaccgctggcgtatgcgctgatcctgctgcgggaaaac
ggcgtgccgagcgtcttttatccggacctctttggcgccagctatgacgatacgggggga
gacggagaaacgtaccatattgatatgcctgtgattgagcagctccacgaactgatcctt
gcgcgccagcgttttgcccacggcgtacagacgctgttttttgatcatcctaactgcatc
gccttcagccgcagcggcacagaagacgatcccggctgcgtggtggtgatgtcgaacggt
gacgacggcgagaaggtaatttgcctgggggaaaactacggcaacaaaacgtggcgtgat
tttctcggcaatcgcgaagaaacggtcaccacggcggcggatggcgaaggaacgtttacc
tgcaaaggcggaagcgtcagcgtgtgggtgattgaggatgcgttgtag

DBGET integrated database retrieval system