KEGG   Lactobacillus pentosus: BB562_05780Help
Entry
BB562_05780       CDS       T05251                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lpg  Lactobacillus pentosus
Pathway
lpg00473  D-Alanine metabolism
lpg00550  Peptidoglycan biosynthesis
lpg01100  Metabolic pathways
lpg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lpg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BB562_05780
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BB562_05780
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BB562_05780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpg01011]
    BB562_05780
Enzymes [BR:lpg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BB562_05780
Peptidoglycan biosynthesis and degradation proteins [BR:lpg01011]
 Precursor biosynthesis
  Amino acid ligase
   BB562_05780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_ST ATP-grasp_3 ATP-grasp_4 ATP-grasp Chal_sti_synt_C
Motif
Other DBs
NCBI-ProteinID: AUI78238
UniProt: A0A2K9I041
LinkDB All DBs
Position
1281805..1282917
Genome map
AA seq 370 aa AA seqDB search
METQKKIYVGMLFGGNSSEHDVSKRSAHNIYDAMDKNKYDVDLFLLTKDGIVLSDAATRR
VFDGEPEDQVVAEEMPKLDMSDPLAPIKNLALAKDIDIFYPVVHGNLGEDGTLQGLFKLL
KKPYVGSGVLASAASFDKDITKQILTHHHIQNTKYVVVTPENREQMTYAYLQAHVGDHLF
IKPANQGSSVGIHKAENEQEYLDGLADAFKYDYKILVEESIDNPREVECSILGNEDPKAS
KLGAIDVPKTDTFYDYNNKFVDASGVTFELPVELPADLTQRIQQMSLDAFKALGLKGMAR
VDFLVSEDGEPYLGEINTLPGFTNISLYPKLWEVSGISYTDLIDQLIQLGFDEFKRQSEI
HYDFVALDAE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggagacacaaaaaaagatctacgttgggatgttatttggcgggaactcttcagaacac
gatgtttcaaagcgttccgctcataacatttatgatgccatggacaagaataagtacgat
gttgatttgtttttactgacaaaggacggaattgtgctaagtgatgccgcaactcggcgg
gtatttgatggtgaaccagaggatcaagtggtggccgaagaaatgccgaagttggacatg
agtgatccattagcacccatcaagaaccttgcactcgctaaggatattgatattttctac
ccagttgtgcacggtaatttaggggaagacgggaccttacagggactcttcaaactattg
aaaaagccgtatgttgggagtggcgtgttagcttctgctgctagtttcgataaggacatt
accaagcagattttgacacaccatcacattcagaacaccaagtatgtcgtggtaacgcct
gaaaaccgggaacaaatgacctatgcttatttgcaagcacacgttggcgatcatttattc
attaagccagcgaaccaagggtcatcggtcgggatccacaaggctgaaaacgagcaggaa
tatctggacggcttagcagatgccttcaagtatgactacaagattttggtcgaagaatcc
atcgacaatccgcgtgaagtcgaatgctcaatcttgggtaacgaagatccgaaagcttct
aagcttggtgccatcgacgtgcctaagacggatacgttctacgattataacaataagttc
gtggacgcgagtggtgtgaccttcgaattacctgtcgaattgcccgcagatttaacacaa
cggattcaacaaatgtcattagatgcctttaaagccttagggttgaaaggcatggcccgc
gttgacttcttagtttctgaagatggcgaaccttatttgggtgaaatcaacaccttacct
ggtttcacgaatattagtttgtatccgaaattatgggaagtctcaggaatcagttatact
gatttgatcgatcagttgattcaacttgggtttgatgaatttaaacgtcaatctgaaatt
cactacgattttgtggctttggacgcagaataa

DBGET integrated database retrieval system