KEGG   Lactobacillus plantarum WCFS1: lp_0518
Entry
lp_0518           CDS       T00115                                 

Gene name
murF
Definition
(RefSeq) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00300  Lysine biosynthesis
lpl00550  Peptidoglycan biosynthesis
lpl01100  Metabolic pathways
lpl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    lp_0518 (murF)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lp_0518 (murF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    lp_0518 (murF)
Enzymes [BR:lpl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     lp_0518 (murF)
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase DUF3323
Other DBs
NCBI-GeneID: 1061788
NCBI-ProteinID: YP_004888524
UniProt: F9UKZ5
LinkDB
Position
463650..465038
AA seq 462 aa
MKMQVAEIAKAVQAVNAEQAWPDVNVTGVAFDSRKLQAGDLFIPLMGANDGHQYIQSAIE
HGAVATLWASDHADDVPEDLPVIMVADTLTALQQLGQYYLQKINPKVVAVTGSNGKTTTK
DMIASVLSTQFNVTKTHANFNNQIGVPVTLLSMEPNTEVVVVEMGMDHFGELDFLSRLVQ
PDVAVITMIGEAHIEFFGTRDRIADAKMEIVHGLKEDGTFIFNGDEPLLQERAKEVSQHQ
RTFGLDDTNTLAGSDITTSRAQTQFKTSLWPDNTYTIPMMGAYNVNNALAALLVADTFHI
RPAAAQQAIASFVPTENRTEWLTGYRGEAILSDVYNSNPTAARRVLAAFAAVPTKGQRIA
VLGDMLELGDQSDALHMSLASELDPATIASVYLNGEHMRALAEVLQEKYPAGAVHYYQTD
QQPQLIADLTATVSADDQVLLKGSHGIHLEKVLTALEAAPEK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgaagatgcaagttgccgaaattgctaaggccgttcaagcggtcaatgccgaacaggcg
tggcccgatgttaatgtaacgggtgtggcgtttgatagccgaaagctccaagcaggggat
ctatttattccgctgatgggcgctaatgatggtcatcaatatattcaaagtgcaatcgag
cacggggccgttgctaccttatgggccagcgaccatgccgacgacgttccagaagactta
cctgtcattatggttgctgatacattgacggcactacagcagctggggcaatactattta
caaaaaattaatccgaaagtcgtggctgttacgggtagtaatggtaaaacaacgacgaag
gatatgattgcgagtgttttgagcactcagtttaacgtgacaaagacgcacgccaacttt
aataatcagattggtgtgccagtgacgttactcagtatggaaccgaatacagaagtggtc
gtcgttgaaatggggatggaccattttggcgagttggatttcttgagccgtctcgttcaa
ccagacgttgcggtgattaccatgattggggaagcccacattgagttctttggtacacgg
gatcgaattgctgatgccaaaatggaaattgtccacggcttaaaagaagatggcacgttc
atttttaatggtgatgaaccactgctacaagaacgtgctaaggaagtcagtcagcatcaa
cggacgtttgggttggatgatacgaacaccttagcaggcagtgatatcacgactagtcgg
gctcaaacgcaatttaagacgagtctgtggccggacaacacgtacacaattccgatgatg
ggtgcgtacaatgtcaataatgcattggcggcactcttggtagctgatacttttcacatt
cgaccagccgctgcgcaacaagcaatcgccagttttgtgccgacggagaaccggacggaa
tggttaactggttaccgtggagaagccatcttaagtgatgtttataactctaatccaacg
gcagctcgacgggtcctagccgcttttgcggcggtacctactaagggtcagcgaatcgct
gtactcggtgatatgcttgagttgggtgaccagtcggatgcactacacatgagtttagcc
agtgaattggatccagccacgattgccagcgtctatttgaatggtgaacatatgcgagcg
ttggcagaagtgctacaagaaaagtacccagccggtgcggtccactattatcaaacggat
caacaaccccaattgattgccgacttaacggcgacggttagtgcggatgatcaggtctta
ttgaaggggagtcacgggattcaccttgaaaaggttctgacggcgctggaagctgctcct
gaaaaataa

DBGET integrated database retrieval system