KEGG   Lactobacillus plantarum WCFS1: lp_1751
Entry
lp_1751           CDS       T00115                                 

Gene name
pbp1A
Definition
(RefSeq) transpeptidase-transglycosylase (penicillin binding protein 1A)
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00550  Peptidoglycan biosynthesis
lpl01100  Metabolic pathways
lpl01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lp_1751 (pbp1A)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    lp_1751 (pbp1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lpl01003]
    lp_1751 (pbp1A)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpl01011]
    lp_1751 (pbp1A)
Enzymes [BR:lpl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     lp_1751 (pbp1A)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     lp_1751 (pbp1A)
Glycosyltransferases [BR:lpl01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   lp_1751 (pbp1A)
Peptidoglycan biosynthesis and degradation proteins [BR:lpl01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   lp_1751 (pbp1A)
SSDB
Motif
Pfam: Transgly Transpeptidase Apt1
Other DBs
NCBI-GeneID: 1061674
NCBI-ProteinID: YP_004889558
UniProt: F9UPA5
LinkDB
Position
complement(1589400..1591703)
AA seq 767 aa
MAGNNEQNSRVARRKSQPKPPKKHWFRRIILSLAALFVIGVLAGLALFFYYAQTAPTVKQ
SDLVNTGTAKIYDQNDKYLTSLGTNDHEYVKSSNIPSTLKNAVVSIEDRRFYKHKGVDYY
RILGAAVGNLKGSSLGMQGGSTLTMQLVKLAVFSTSTSDRNLKVKAQEAWIALNLEKHYS
KSQILEFYINKVYMGNGIYGMGTAAKYYYGKSLKDLSLSQLALLAGMPQSPTYYDPTTYP
SYATSRRNLVLEAMYDNKVISKSQETAAEKVSVKTGLTSSGRSSLAKHEKTNKILDAYLN
EVRQDLLKKGYNLTDGEKVYTNIDMDAQKRLYDIANTSQYVNYPNNGKQTFQLGVSVVDS
YTGKVSAMIGGRKTGNVTYGTNRAVWTSRSNASTMKPILDYGPAIEYLNWPTYKSLSDTK
YKYPGTNISVHDFDNNYLGNMTMREALVQSRNIPAIRALQAVGKSRAKTFANNLGMNLKT
VNYANGIGAGVSTLQVAGAYAAFANGGVYHKPYYIRKVTTSDGVTTSYTSTGKRAMKKST
AYMITDMLKGVINSSTGTATTAKISGVYQAGKTGTDNYASQYKNKVPSDAVVDSWMAGYT
KNYSVAVWTGYDKSTEAGGYLDTSNEKISQQIYRAMMNYLQQYSPNSDWTKPSSVGTTKK
NGIEELYVVGHLFSSSEASSGTASSASSSSTTTGSSSTSTEASSRSSESSSSSSEAASSS
SSAESSSSESSSESSSSSEASSSSEASSEATLSETPTADTNNTTEGQ
NT seq 2304 nt   +upstreamnt  +downstreamnt
atggcaggtaacaatgaacagaactcacgggttgctcgcagaaaaagccaacctaaacca
cctaagaaacactggtttcggcggattattttatccttagctgcactgtttgtcatcggg
gtactcgctggtctagcacttttcttctactatgcgcagacggcaccaacagtcaaacag
agtgaccttgtcaatacggggaccgctaagatttatgaccagaacgacaagtatttgacc
tctttgggaactaacgaccacgaatacgttaagtctagtaatatcccatccacacttaag
aatgccgtcgtctcaatcgaagatcgccgtttttacaagcataagggggtcgattattac
cggattcttggggctgcagtcggcaacttaaaaggtagctcactcgggatgcaaggtggg
agtaccttgaccatgcaactcgttaaacttgcggtcttttccaccagtacttcggatcga
aatttgaaagtcaaagcgcaggaagcctggattgcgcttaatcttgaaaaacattacagt
aaatctcagattctggaattttacatcaataaggtctatatgggtaacgggatttatggt
atggggactgccgccaagtattattacggtaagtcattaaaagatctgagccttagtcaa
ctcgcactgctcgcaggtatgccgcaatcaccaacctactacgacccgacgacttatcca
tcatacgcaactagccgccgtaatctggtgctggaagcgatgtacgataacaaggtcatc
tccaagagtcaggaaactgctgctgaaaaagtcagtgtcaagacgggcttaactagttcg
ggacgttcaagcctagcgaagcatgaaaagacaaataaaatcttggatgcttacctgaac
gaagtccgtcaagacctcctcaaaaaaggttataatttaaccgatggcgagaaagtttat
acgaacattgacatggatgcccagaaacggctttatgacattgccaacacgtctcaatac
gtcaactatcctaataatggaaaacagactttccaattaggggtatcggttgttgactca
tacactggcaaggtctcagctatgattggtggtcggaaaaccggtaatgtcacgtacgga
accaaccgagctgtctggacatcacgctcaaacgcttcgacgatgaaaccgattctcgat
tatggaccagccattgaatatttgaattggccaacttacaagtcgttgtctgatacgaaa
tacaaatatcccgggactaacatttccgtgcatgactttgacaataattacttgggcaat
atgacgatgcgtgaagcactggttcaatcacggaacatcccagcaattcgggccttacaa
gccgttggtaaaagccgagccaaaacctttgccaataaccttgggatgaacctcaaaacc
gttaactatgccaacgggatcggtgctggtgtttccaccttacaagttgccggtgcctac
gctgcgttcgccaacggtggtgtttatcataagccatactacatccgtaaagtgactact
tctgatggcgttacgacatcgtatactagcactggtaagcgcgccatgaagaaatcaacg
gcatacatgattactgatatgctgaaaggggtcatcaatagttctactgggacggcgaca
accgctaagatcagcggcgtttaccaagctggtaagactggtactgacaactatgcttct
cagtataaaaacaaagtaccatccgatgccgtcgttgactcatggatggccggttacacg
aagaattattcggtcgccgtttggactggctatgataagtccaccgaagctggtggttat
ctagatacctcaaacgaaaagatttcacaacaaatttatcgcgccatgatgaattacctt
caacagtattcaccaaactctgattggaccaaaccaagctcagttggcacgactaagaag
aacggtatcgaagaactttacgttgttggtcacctcttctccagtagtgaagcctcgtca
ggaaccgctagttcagctagctctagttcaacaacaacgggtagttcaagcaccagcaca
gaagcaagtagtcgtagttcggaaagtagcagtagtagttccgaagctgcttcttcctca
agtagcgccgaaagttcatcttctgaatctagttcagaaagtagcagcagttcggaagca
agttcaagctccgaagcaagttccgaagcgactttatcggaaacaccgaccgctgatacc
aataacacgactgaaggacaataa

DBGET integrated database retrieval system