KEGG   Lactobacillus plantarum WCFS1: lp_2180
Entry
lp_2180           CDS       T00115                                 

Gene name
iscS
Definition
(RefSeq) cysteine desulfurase
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00730  Thiamine metabolism
lpl01100  Metabolic pathways
lpl01240  Biosynthesis of cofactors
lpl04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    lp_2180 (iscS)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    lp_2180 (iscS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lpl03016]
    lp_2180 (iscS)
   03029 Mitochondrial biogenesis [BR:lpl03029]
    lp_2180 (iscS)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:lpl02048]
    lp_2180 (iscS)
Enzymes [BR:lpl01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     lp_2180 (iscS)
Transfer RNA biogenesis [BR:lpl03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    lp_2180 (iscS)
 Prokaryotic type
    lp_2180 (iscS)
Mitochondrial biogenesis [BR:lpl03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    lp_2180 (iscS)
Prokaryotic defense system [BR:lpl02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   lp_2180 (iscS)
SSDB
Motif
Pfam: Aminotran_5 Pyridoxal_deC Beta_elim_lyase NIDO B12-binding MoCF_biosynth
Other DBs
NCBI-GeneID: 1063619
NCBI-ProteinID: YP_004889916
UniProt: F9UQB3
LinkDB
Position
complement(1969471..1970631)
AA seq 386 aa
MKQVYLDNAATTPMAASVIQTMTDQMTNTFGNASSTHAFGRAAREVLDDSRHVIAQSINA
ADDDIIFTSGGTESDNTAVMQTAWTRQHLGKHIITTAIEHQAILKSTAFLAEHGFEITYL
PVNEQGQISLDDLKAALRPDTILVSIMTGNNEVGSQMPIHEIGELLKDHQAWFHTDAVQA
YGLLDIDVQRDHIDMLSTSAHKINGPKFLGFLYRRNGINFPSFVKGGEQEDKRRAGTENI
PAIAGFATAVQELTTAEKTHRQAKYREFKQYIVDQLTANGVDFEVNGSLGEHNLQHVLNL
WIKGVSTYTMQTNLDLAGVAVSGGSACTAGSLEPSHVLIAMYGEDSPRISESIRLSFGRY
TTKADLDQFVTVLTKTTQRLLKKQGA
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgaagcaagtgtacctagacaatgcggcaacgaccccaatggcagcgtccgttattcag
acgatgacggatcaaatgacgaatacgtttggcaatgcctcaagcacccacgcattcggt
cgggccgcccgtgaagttttagacgatagtcggcacgtgattgcccaaagcattaacgca
gctgacgatgacattatctttaccagtggtggtacagaaagtgataatacggcggtgatg
cagaccgcgtggacgcgccaacatttaggcaagcatattattacgacggcaatcgaacat
caagcaattcttaaatcgactgcttttttggcagaacatgggtttgagattacttattta
cccgtgaatgaacagggacaaattagtctggatgatttgaaggcggcactacgtcctgat
acgattctcgtctcaatcatgaccgggaataatgaagttggttcacagatgccaatccat
gaaattggtgaattgttaaaggatcaccaggcatggttccatacggatgcagtgcaggcc
tacgggttgttggatattgatgtgcaacgggatcatattgacatgttgtccacctcagca
cataaaatcaatgggcctaaattcttgggcttcttgtatagacgcaatggcattaacttt
cctagctttgtcaagggtggcgaacaggaagataagcgccgtgccggtactgaaaatatc
ccggcaatcgcgggctttgccacggccgtgcaagaactgacgaccgctgagaaaacccac
cggcaggctaagtatcgtgagttcaagcaatacatcgttgaccagttaacggctaacgga
gttgattttgaagtcaacgggtccctcggtgagcataacttgcaacacgttttgaactta
tggatcaaaggggtatcgacctatacaatgcaaactaacctggacttagctggtgtcgca
gtttctgggggctccgcatgtacggcggggagcctagaaccatcacacgttttaattgca
atgtatggtgaagactctccccggatcagcgagtcgattcggttgagctttggtcgctat
actactaaggctgatctggatcagtttgtaacggtgctgacgaagacgacgcagcgctta
ttaaaaaagcagggggcgtga

DBGET integrated database retrieval system