KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg1002
Entry
lpg1002           CDS       T00199                                 

Definition
(RefSeq) hypothetical protein
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
SSDB
Other DBs
NCBI-GeneID: 19832567
NCBI-ProteinID: YP_095035
Pasteur: lpg1002
UniProt: Q5ZWT3
LinkDB
Position
complement(1092009..1092422)
AA seq 137 aa
MLRTTIIGLLALSSLQIQAANITQVGRYATVNNQPLAAQINPLKTVQQIHFPSSVQTIGE
AVEYWLRYSGYHLAPQDKQNESLKQIFQQPLPQVTRNLGPLTIADGLTVLVGKTLFSLKQ
DDLLREINFSLNARRAQ
NT seq 414 nt   +upstreamnt  +downstreamnt
atgttgagaacaaccattattggccttttagccctaagcagcctgcaaatacaagctgct
aatatcacccaggttggacgttatgctaccgtgaataatcaacccctggcagcacagata
aatccgcttaaaacagtccagcagattcatttcccaagctcagttcaaacgataggtgaa
gcggttgagtattggcttcgttattcaggttaccatcttgctccccaggataagcaaaac
gaaagccttaaacaaatcttccaacaacccctaccccaagtcaccagaaaccttggtcct
ttaactatagccgacgggctcacggtattggttgggaaaaccctgtttagcctcaagcag
gatgacctcttaagagaaatcaatttcagtcttaatgcaaggagagcacaatga

DBGET integrated database retrieval system