Lactiplantibacillus plantarum ZJ316: zj316_1670 Help Entry zj316_1670        CDS       T02458                                  Symbol acpA2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism lpt  Lactiplantibacillus plantarum ZJ316 Pathway lpt01100   Metabolic pathways lpt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lpt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     zj316_1670 (acpA2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     zj316_1670 (acpA2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF4277 DUF6290 PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  AGE39209 LinkDB All DBs Position 1728960..1729208 Genome browser AA seq 82 aa AA seqDB search MTKTEIFDQIKKMIVEQLDVDADKITMTTNFTEDLALDSLDVFEVIDKIEDEYDIEIETD DALATVGDLVDYVATHQETSED NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgactaaaactgaaatttttgaccaaattaaaaagatgatcgtggaacaattagacgtg gatgctgacaagattacgatgacaacgaactttaccgaagacttagcacttgatagtctg gacgtttttgaagtgatcgataagatcgaagacgaatatgatatcgaaatcgaaacggat gacgctttagccacggttggtgatttagttgattatgtggcgactcatcaggaaactagc gaggactaa

DBGET integrated database retrieval system