Lactiplantibacillus paraplantarum: ASU28_06750 Help Entry ASU28_06750       CDS       T04156                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lpx  Lactiplantibacillus paraplantarum Pathway lpx01100   Metabolic pathways lpx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lpx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ASU28_06750   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ASU28_06750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ALO04069 UniProt:  A0A098R474 LinkDB All DBs Position 1449843..1450088 Genome browser AA seq 81 aa AA seqDB search MTKEEIFDKIADIIADRFEVDKATITNEMNLQTDLDADSIDFVEFVLELEDTFGSEISDE DAEKLSTVGEVVDYVAAHQAK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacgaaagaagaaattttcgataaaattgcggatatcattgctgatcggtttgaagtt gataaagcaacgattaccaacgaaatgaacttgcaaaccgatttggatgctgattccatc gattttgttgagtttgtactggaattagaagacacctttggtagcgaaatctcagacgaa gatgccgaaaaattgtcaacggtcggcgaagttgtcgattatgtggcagcgcaccaagca aaataa

DBGET integrated database retrieval system