KEGG   Leminorella richardii: NCTC12151_01900Help
Entry
NCTC12151_01900   CDS       T05503                                 

Gene name
gstB
Definition
(GenBank) Glutathione S-transferase GST-6.0
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lri  Leminorella richardii
Pathway
lri00480  Glutathione metabolism
lri01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lri00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NCTC12151_01900 (gstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lri02000]
    NCTC12151_01900 (gstB)
Enzymes [BR:lri01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NCTC12151_01900 (gstB)
Transporters [BR:lri02000]
 Other transporters
  Pores ion channels [TC:1]
   NCTC12151_01900 (gstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2 Tom37 GST_N_5
Motif
Other DBs
NCBI-ProteinID: SQI41025
UniProt: A0A2X4XM70
LinkDB All DBs
Position
1:2011927..2012532
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLSPHIILNEIGLNYSVEKVDLATKKTEHGDDFLQVNPKGQVPTLQLNDG
SILTEGVAIVQYLAHRAPAKHLLPTVDTMDYYHAIEWLNYISTELHKGFSPLFNPQTPED
FKLVTKDRLFKQFSYVNSVLEKRPHILGATFSVADAYLFTVTRWAAAVKLDLSSLKALTD
YMTRISERPAVKAALKAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagctattttataaaccgggcgcctgttccctgtctccgcacattattctgaacgaa
ataggcttgaactattccgttgagaaggtcgatctggccaccaaaaagaccgagcacgga
gatgacttccttcaggttaaccctaaggggcaggtgccgacgcttcagctcaacgacggc
agtatcctcacggaaggcgtcgctatcgtacaatatttagcacatcgggcgccggccaag
cacctgctgccgaccgtagacaccatggactattatcacgctattgagtggttgaactac
atttcaacagagcttcataaaggatttagcccactgtttaatccacaaaccccagaagat
tttaagctggtgaccaaagacaggctgttcaaacagtttagctacgtcaacagcgtgctg
gaaaagcgtccacatattttgggagcaacatttagcgtagccgatgcctatctgtttact
gtcactcgctgggctgcggcggtaaaactggatctgagcagtcttaaagcactgactgac
tacatgactcggatctcagaacgccctgccgtcaaggcagcgctgaaggctgaaggcctg
aagtaa

DBGET integrated database retrieval system