Legionella sainthelensi: CAB17_07100 Help Entry CAB17_07100       CDS       T05293                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism lsh  Legionella sainthelensi Brite KEGG Orthology (KO) [BR:lsh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:lsh03110]     CAB17_07100 (grxC) Chaperones and folding catalysts [BR:lsh03110]  Protein folding catalysts   Protein disulfide isomerase    CAB17_07100 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Thioredoxin_3 DSBA Glrx-like Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  AUH71860 UniProt:  A0A2H5FK09 LinkDB All DBs Position complement(93845..94099) Genome browser AA seq 84 aa AA seqDB search MAEIIMYSTGYCPYCTRARELFHQKNAVFTDIRVDLHPELREEMITKSGRRTVPQIFIDG QHIGGCDDLYALDAQGQLDQLLRG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggctgaaataatcatgtacagtactggctattgtccgtactgcaccagagcacgagag ttattccaccagaaaaatgctgtgtttactgatattcgtgttgatttacaccctgaatta cgtgaagaaatgataaccaaaagtggtagacgtaccgtgccacaaattttcatcgatggc caacatattgggggctgcgatgacttatatgccctggatgcccagggacaactcgatcaa ttactaagaggatag

DBGET integrated database retrieval system