KEGG   Lactobacillus salivarius JCM1046: LSJ_0490Help
Entry
LSJ_0490          CDS       T03340                                 

Gene name
fabI
Definition
(GenBank) Enoyl-[acyl-carrier protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lsj  Lactobacillus salivarius JCM1046
Pathway
lsj00061  Fatty acid biosynthesis
lsj00780  Biotin metabolism
lsj01100  Metabolic pathways
lsj01130  Biosynthesis of antibiotics
lsj01212  Fatty acid metabolism
Module
lsj_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lsj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LSJ_0490 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LSJ_0490 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    LSJ_0490 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lsj01004]
    LSJ_0490 (fabI)
Enzymes [BR:lsj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     LSJ_0490 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     LSJ_0490 (fabI)
Lipid biosynthesis proteins [BR:lsj01004]
 Fatty acid synthase
  Component type
   LSJ_0490 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AIR10188
UniProt: A0A089QEG2
LinkDB All DBs
Position
498692..499450
Genome map
AA seq 252 aa AA seqDB search
MSDLLKGKKIIVMGVANKRSIAWGCSQMMMENGAELIFTYQNDRIKKSLSRLVSEEEKLV
ECDVSDDASIENAFKLVNERFGKVDGILHAIAFANKEELGGEIMQASREGYALAQDISAY
SLIAVAKYGREILNDPSSIVTLTYFGSERAIPNYNVMGVAKASLEASVRYLARDMAKYGT
RVNAISAGAIKTLAVTGIKGHSELLKMSEERTVDGESVTIREVGGTCAFLMSDLSTGVVG
DVIYVDKGVHLI
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacttgttaaaaggaaagaaaatcattgttatgggagtagctaataagcgttca
attgcatggggatgttcccagatgatgatggaaaatggggctgaattaatattcacatat
caaaatgacagaataaaaaaaagtttgagtcgtttagtttctgaagaagaaaaactagta
gaatgtgatgtttcagatgatgcaagtattgaaaatgcctttaaattagtgaatgaacgt
tttggaaaagtagatggaattttgcatgcaattgcttttgctaacaaggaagaattgggt
ggagaaattatgcaagctagtcgcgaaggatatgcattagctcaagatatttcagcatat
tccttaattgcggttgcaaagtacggtcgtgaaattttaaatgatccatctagtattgta
acattaacttattttggttcagaaagagctatccctaactataatgtcatgggagtagct
aaagcatctctagaagctagtgtccgttatttagctcgtgacatggctaagtatggtact
agagttaatgctatttctgcaggagcaataaagacattggctgttactggaattaaaggt
cattcagagttattaaaaatgtctgaagaaaggacagttgatggggaatcagtaacaatt
agagaagtaggcggaacatgtgcattcttgatgagtgacttgtcaacaggtgtcgtaggc
gatgttatttacgtggataaaggagtccatttaatatag

DBGET integrated database retrieval system