KEGG   Lonchura striata domestica (Bengalese finch): 110474760
Entry
110474760         CDS       T05897                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110474760 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lsr04030]
    110474760 (PTGDR)
G protein-coupled receptors [BR:lsr04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    110474760 (PTGDR)
SSDB
Motif
Pfam: 7tm_1 PhoR
Other DBs
NCBI-GeneID: 110474760
NCBI-ProteinID: XP_021394105
LinkDB
Position
5
AA seq 361 aa
MEPAGYRCRSSRHIESGQSAVPSSVLFAAGLLGNVLALLLLGQHRRRSRSPGGRPPRVSA
FYVLVTALAVTDLLGKCLISPMVLAAYAYNRSLSELGPGGRGEEQPGVLCQLFAFLMAFF
GLAPTLLLLAMALECWLSLGHPYFYRRHLTRRLGAALGPAAAGLCALFCALPLLGFGAPM
QYCPGTWCFIRMAGGGAGQLGFPVLYASLMGLLVLAIVACNVSSMRHLYGMARRQPRRGT
PPAAAPRMEELDHLVLLGLMTVLFTVCSLPLIIRAYMGAFAADFNENADLSALRFLSVNS
IVDPWVFIIFRTSVFRAFVRRVCRRLGSRRASLKGSGPAGDSQFCPPGWQGGTDPPRLGT
P
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggagcccgcgggttaccgctgccgcagcagccgccacatcgagagcgggcagtcggcc
gtgcccagctcggtgctgttcgccgccggccttttggggaacgtcctggcgctgctgctg
ctgggccagcaccgccgccggtcccggtcgcccgggggccgcccgccgcgggtgtcggcg
ttctacgtgctggtcacggcgctggcggtcaccgacctgctgggcaagtgcctgatcagc
cccatggtgctggcagcgtacgcctacaaccgcagcctcagcgagctggggccggggggc
cgcggcgaggagcagccgggggtgctctgccagctcttcgccttcctcatggccttcttc
gggctggcccccacgctgctgctgctggccatggctctggagtgctggctttccttgggc
cacccctacttctaccggcggcacctgacccgccgcctgggtgccgcgctggggccggcg
gccgccgggctgtgcgcgctgttctgcgccctgcccctgctggggtttggggctcccatg
cagtactgccccggcacatggtgcttcatccgcatggccggcggtggtgcgggccagctg
ggcttccccgtgctctacgccagcctgatgggcttgttggtgctggccatcgtggcgtgc
aacgtgagcagcatgcggcacctgtacggcatggcccgcaggcagccccgccgcgggacg
ccccccgccgccgccccgcgcatggaggagctcgaccacctcgtcctgctggggctcatg
accgtcctcttcaccgtctgctccctgccgctcatcatccgggcctacatgggagctttt
gccgccgatttcaacgagaacgccgacctgagcgcgctgcgcttcctctccgtcaactcc
atcgtggacccctgggtcttcatcatcttccgcacctccgtcttccgcgccttcgtgcgc
cgcgtctgccgccgcctgggctcccgccgagcctcgctgaaaggctccggccccgctggt
gacagccagttctgtcccccgggctggcagggtggcacagatcccccccggctgggcacc
ccctga

DBGET integrated database retrieval system