KEGG   Lachancea thermotolerans: KLTH0E09658g
Entry
KLTH0E09658g      CDS       T01117                                 

Definition
(RefSeq) KLTH0E09658p
  KO
K12766  serine/threonine-protein kinase MDS1/RIM11 [EC:2.7.11.1]
Organism
lth  Lachancea thermotolerans
Pathway
lth04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:lth00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    KLTH0E09658g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lth01001]
    KLTH0E09658g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     KLTH0E09658g
Protein kinases [BR:lth01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   KLTH0E09658g
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase WHIM1 Kdo NGF
Other DBs
NCBI-GeneID: 8292059
NCBI-ProteinID: XP_002553895
UniProt: C5DI47
LinkDB
Position
E:869857..870957
AA seq 366 aa
MEIQAITNSSIVHKQVFEGHSHAKQDREQDTITISYPATEVVGHGSFGVVFTTQVRETGD
RVAIKKVLQDRRFKNRELEVMKQLQHPQVVDLKYYFYETDPQGEVYLNLILEFMPQSLYQ
RLRHFVSQRSNMPRIEIKLYMYQLAKCLNYLHKHAAVCHRDIKPQNLLVDPETYALKLCD
FGSAKQLKPSEPNVSYICSRYYRAPELIFGATNYTVQIDIWSSGCVMAELILGQPMFPGE
SGIDQLVEIIKILGTPTKQEICSMNPNYMEHKFPQIRPIPLAKVFKREDQETIQLLSDVL
RYNPTERFTALQCLCSPYFDELRSTTDPELASVVSNLRLMEFCDEYEFDTLTPEEAKVIK
QRLQPS
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggagatacaagcaattactaacagtagcatagtccacaaacaggttttcgaaggtcac
agccatgcgaagcaggaccgcgagcaggacacgatcacaatctcataccccgccaccgag
gtggtggggcacgggtcctttggcgtcgtgttcaccacgcaggtgcgcgagaccggcgac
cgcgtggcaatcaagaaggtgctgcaggaccgccgcttcaagaaccgtgagcttgaagtc
atgaagcagctgcagcaccctcaagtcgtggacctaaagtactacttctacgagacagac
cctcagggcgaggtctacctgaacttaatcctcgagttcatgccccaatcgctgtaccaa
cggttgcgccactttgtctcgcagcgatccaacatgccgcgcatcgagataaagctgtac
atgtaccaactggccaagtgtctcaactacctgcacaagcatgcagctgtctgtcaccgc
gacatcaagccgcaaaacctattggtggaccccgagacgtatgcgctcaaactctgcgac
ttcggcagcgcgaaacagctgaagccctccgagcccaacgtctcctacatctgctcgcgc
tactaccgtgctcctgaactcattttcggcgctaccaactacacagttcagatcgacatt
tggtccagcggatgtgtcatggcggagcttattctgggccagcctatgtttcccggagaa
agtggcattgatcaacttgtggagatcatcaagatcctgggcactccaacaaaacaagag
atctgttccatgaatcccaactacatggaacacaagttcccgcaaatacggcccattcct
ttagccaaggttttcaaacgcgaagatcaagagaccatacagctcttatcagatgttctg
cgatacaaccctaccgaaaggtttacggcgttgcagtgcttgtgctcgccttactttgac
gagctgcgcagcaccactgacccagagcttgcgtctgtggttagcaacttaagactgatg
gagttctgcgatgaatacgaattcgataccctgacaccggaagaagccaaggtgattaag
cagcggcttcagccttcatag

DBGET integrated database retrieval system