KEGG   Luteimonas sp. Gr-4: FPZ22_10465Help
Entry
FPZ22_10465       CDS       T06154                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lug  Luteimonas sp. Gr-4
Brite
KEGG Orthology (KO) [BR:lug00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FPZ22_10465 (ahpF)
Enzymes [BR:lug01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FPZ22_10465 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO Glutaredoxin NAD_binding_8 Thi4 FAD_binding_3 NAD_binding_9 FMO-like K_oxygenase AlaDh_PNT_C Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: QDW67252
UniProt: A0A518N5Q3
LinkDB All DBs
Position
complement(2275377..2276975)
Genome map
AA seq 532 aa AA seqDB search
MLEDDLKTQLKAYLERLQRPVVLVASVDDGAKSAEMLELLEDIRALSDKVSVEVSRDDAH
RKPSFAITSPGQDIDLRFAGLPMGHEFTSLVLALLQVGGHPSKAAPELLEQVRNLEGEYR
FETYFSLSCQNCPDVVQALNLAAVLNPGIHHVAIDGALFQDEVEAREVMSVPTVFLNGEV
FDQGRMNLEQIVARLDTGAAKREAAAIAKKDVFDVLVVGGGPAGAAAAVYAARKGIRTGV
ASERFGGQVLDTMSIENFISVPHTEGPRLAAQLEAHVREYEVDIMNLQRATALTQDADGV
TTIQLESGASVRGRTVVLATGARWRQMGVPGEDEYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLIEFDGKLRADEVLQRKLRSLSNVRIITSAQTTEVLGDGK
RVNGLVYRDRVGGDSHRVELEGVFVQIGLLPNTEWLKGSIELSPRGEIVVDAAGRTSLPG
VFAAGDATTVPYKQIVIAMGEGAKASLSAFDHLIRSSSPAAVAVAGAEAATA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagacgatctcaagacccagctcaaggcctacctggagcgcctgcagcgcccg
gtggtgctcgtggccagcgtcgatgacggcgcgaagtcggccgagatgctcgagctcctg
gaggacatccgcgcgctgtccgacaaggtgagcgtcgaggtgtcgcgcgacgacgcccac
cgcaagccctccttcgccatcacctcgccgggccaggacatcgacctgcgtttcgcgggc
ctcccgatggggcacgagttcacctcgctggtgctggcgctcctgcaggtcggcggccac
ccgtccaaggccgcgccggagctgctggagcaggtccgcaacctcgagggcgaataccgt
ttcgagacctatttctcgctgtcctgccagaactgcccggacgtggtccaggccctgaac
ctggcggcggtgctgaaccccggcatccaccatgtggcgatcgacggcgccctgttccag
gacgaggtcgaggcgcgcgaggtgatgtcggtgccgaccgtgttcctcaacggcgaggtc
ttcgaccagggccgcatgaacctcgagcagatcgtcgccaggctcgacaccggcgccgcg
aagcgtgaggccgcggcgatcgcgaagaaggacgtgttcgacgtactggtggtcggaggc
ggtccggcgggcgcggcggccgcggtctatgccgcgcgcaagggcatccgcaccggcgtc
gcctccgaacgcttcgggggccaggtgctggacaccatgtcgatcgagaacttcatttcc
gtaccgcacaccgagggcccgcgcctcgcggcgcagctcgaggcgcatgtgcgcgagtac
gaggtcgacatcatgaacctgcagcgcgccaccgcgctgacccaggacgccgacggcgtg
accacgatccagctggagagcggcgccagcgtgcgcggccgcaccgtggtgctcgccacc
ggcgcgcgctggcggcagatgggcgtgcccggcgaggacgagtaccgcaacaagggcgtg
gcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggccgtgatcggc
ggcggcaactcgggcgtcgaagccgcgatcgacctggccggcatcgtcagccacgtcacc
ctgatcgaattcgacgggaagctgcgcgccgacgaagtcctgcagcgcaaactgcgcagc
ctgtccaacgtgcgcatcatcacctcggcccagaccaccgaggtgctcggcgacggcaag
cgcgtcaacgggcttgtctatcgcgaccgcgtcggcggcgacagccaccgcgtcgagctg
gagggcgtgttcgtgcagatcggcctgctgcccaacaccgaatggctgaagggctcgatc
gagctcagcccccgcggcgagatcgtcgtcgacgctgccggccgcacctcgctgccgggc
gtgttcgccgccggcgacgccaccaccgtgccctacaagcagatcgtgatcgccatgggc
gaaggcgcgaaggcctcgttgagcgccttcgaccacctgatccgcagcagcagcccggcc
gccgtcgccgtcgccggcgccgaggcggccacggcgtaa

DBGET integrated database retrieval system