KEGG   Urechidicola croceus: LPB138_04600
Entry
LPB138_04600      CDS       T04497                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
lul  Urechidicola croceus
Pathway
lul00310  Lysine degradation
lul01100  Metabolic pathways
lul01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lul00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    LPB138_04600
Enzymes [BR:lul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     LPB138_04600
SSDB
Motif
Pfam: DAO NAD_binding_8 Mqo Pyr_redox_3 Thi4 FAD_binding_2 Trp_halogenase Pyr_redox_2
Other DBs
NCBI-ProteinID: AOW20006
UniProt: A0A1D8P607
LinkDB
Position
complement(989784..990968)
AA seq 394 aa
MSNKYDFIIVGGGIVGLATAYKLQLKYPKKSIAVLEKEQIIGKHQTGRNSGVIHSGIYYT
PNSYKARNCKNGREQLVKFAEENEVKYETCGKIIVATTNEEVIILEEIYRKGIKNGTPDI
QFLNSDQIKEKEPFIDGLKAIWVPTAGIIDYVVVSQKMMELLTNINSKSKLICSCYVESI
NNSELKTSKGIYSAEKIIFCTGLNSDRIAKKDAIKTDMKIVGFRGDYYELTEKAKHKINI
LVYPVPDPKFPFLGVHYTPMIDGRIECGPNAVFSFKREGYKTTSFSLKDSYDALTYNGTW
KLFTKHWRKGLEEYKRAFSKKLFVKELQRMMPSIEMDDVVYSRAGVRAQALDKQGNLVDD
FKIEEKNGHIHVLNAPSPAATSCLAIADEIINRI
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgtcaaataagtatgattttataattgttggaggtggaatagttggacttgcaacagca
tataaactacaattaaaatatcctaaaaaatcaattgctgttcttgaaaaagaacaaata
ataggaaaacatcaaactggaagaaactcaggtgtaattcattcaggaatttattatact
cctaactcttataaagcaagaaactgtaaaaatggtagggaacaattagtgaaatttgcc
gaagagaatgaggttaaatatgaaacttgcggtaaaattattgttgcaactaccaatgaa
gaagtaatcattttagaagagatttatagaaaaggaattaaaaacggcacacctgatatc
caattcttaaattcagatcaaataaaggaaaaagagccttttattgatggtttaaaagcg
atttgggtaccaactgctggaattattgattatgtagtagtcagtcaaaaaatgatggaa
ttattaactaatatcaattcaaaaagtaaattaatttgttcttgttatgttgagtcaatt
aataattcagaattaaaaacttcaaaaggaatttattctgctgaaaaaataattttttgt
acaggtctaaattcggatagaattgcaaagaaagatgccattaaaacagatatgaaaatt
gttggttttagaggcgattattatgaattaacagaaaaagcaaagcataaaataaatata
ctagtgtacccagtaccagatccaaaatttccttttttaggtgttcattatacgcctatg
attgatggtcgaatagagtgtggtccgaatgcagtcttttcttttaagcgagaaggttat
aaaactacaagttttagtttgaaggattcttacgatgcattgacatataatggtacttgg
aagttattcacaaaacattggcgaaaaggacttgaagaatataagagagcattttctaaa
aaactatttgttaaagaattacagcgtatgatgccatcaattgaaatggatgatgtagtt
tattctagagcaggagttcgtgctcaagcattagataagcaaggaaatttggttgatgac
tttaagatagaagaaaaaaatggtcatatacatgtattaaatgctccttcacctgcagca
acatcttgtcttgctattgcagatgaaattataaacagaatttaa

DBGET integrated database retrieval system