KEGG   Urechidicola croceus: LPB138_04605
Entry
LPB138_04605      CDS       T04497                                 

Definition
(GenBank) MFS transporter
  KO
K06902  MFS transporter, UMF1 family
Organism
lul  Urechidicola croceus
Brite
KEGG Orthology (KO) [BR:lul00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lul04131]
    LPB138_04605
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lul02000]
    LPB138_04605
Membrane trafficking [BR:lul04131]
 Autophagy
  Other autophagy associated proteins
   Others
    LPB138_04605
Transporters [BR:lul02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Unknown major facilitator-1 (UMF1) [TC:2.A.1.24]
    LPB138_04605
SSDB
Motif
Pfam: ATG22 MFS_1
Other DBs
NCBI-ProteinID: AOW20007
UniProt: A0A1D8P633
LinkDB
Position
complement(990958..992262)
AA seq 434 aa
MLQKGDKKLINGWAFYDWANSVYSLVISTTVFPMYYEAVTNGDGGEVTFLGTEWYNTTVY
TYALGLSFLIVAFLSPILSAIADYTGNKKRFMQFFCLLGSLSVMSLYFFTGKENLWIGIV
FAMLASIGFWGSIVFYNAYLPEVAEPEDHDRVSAKGFMLGYLGSVLLLGFNLSMVMFPEI
YGITDSTLPARISFLTVGVWWFGFAQITFSRLPNNPFKRKPEKDYIFKGYRELQLVLKEI
RNQGQLKILLISFFLYSIGVQAVILLASTFGTKDLGLESQNLIITILLIQIVGIAGAFLF
SRLSGKIGNIKALKITVIIWAFACLGAYLLNKEDPNVDVKFYALGGFIGLVFGAIQTLSR
STYSKLIPDETHDHATYFSFYDVTEKIAIVFGMILAGLVTSYTNSLRLFILILAVFFIAG
FISLSFMKRTKYVK
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgttacaaaaaggcgataaaaaattaataaacggttgggctttttatgattgggcaaat
tctgtttattcgttagtaattagtacaactgtatttccaatgtattatgaggcagtgacc
aatggagatggtggtgaagtaacatttcttggtacagaatggtataatactactgtatac
acttatgctctgggtttatcatttttgatagtagcgtttttatcaccaatcttatctgca
atagctgattatacgggaaataaaaaacggtttatgcagtttttctgtttattaggttcc
ttatccgtaatgtcgttgtatttttttactggtaaagaaaatttatggattggaattgtt
tttgctatgcttgcaagtataggtttttgggggagtatcgttttttataatgcctatttg
ccagaagttgcagagcccgaagaccatgatcgggtgagtgctaaaggatttatgctaggg
tatttggggtcagttttattattaggatttaacttgtcaatggtaatgtttccagaaata
tatggaataactgattcaactttacctgcaagaatttcatttttaactgtaggtgtttgg
tggtttggttttgcgcaaataacttttagtagattgccaaataacccatttaaaagaaag
cctgaaaaagattatatttttaaaggatatagagaactacaattagttttaaaagaaata
agaaatcaaggccaattaaaaattcttttaatttcatttttcctatatagtattggtgta
caggcagtaatattattagcttcaacatttggtacaaaagatttaggcttggaatctcaa
aacttaattattactattttattaattcaaattgttggaattgctggagcgtttttgttt
tcgagattatcaggaaagataggtaatattaaggctttgaaaattacggtaataatttgg
gcttttgcatgtttaggagcttatttactcaacaaagaagatccaaatgtagatgtgaaa
ttctatgctttaggaggatttattggtttggtatttggtgcaatacaaactctttcacgt
tcaacttattctaaattaattcctgatgaaacacatgatcatgcaacttattttagtttt
tatgatgttactgaaaaaattgcaattgtatttggaatgattctcgctggattagtaact
tcgtatacaaattctttgcgtttgtttattttgattttagcagtattttttattgctgga
tttatttctctaagctttatgaaacgaacgaagtatgtcaaataa

DBGET integrated database retrieval system