KEGG   Lutibacter profundi: Lupro_04110
Entry
Lupro_04110       CDS       T04235                                 

Definition
(GenBank) secondary thiamine-phosphate synthase
Organism
lut  Lutibacter profundi
SSDB
Motif
Pfam: UPF0047
Other DBs
NCBI-ProteinID: AMC10485
UniProt: A0A0X8G5M8
LinkDB
Position
complement(938015..938437)
AA seq 140 aa
MKFYQKEIQLEPFNRGFHLITRIILNQFEEIGNIEVGQLQVFIKHTSASLTINENADSSV
RTDFENYFNRIVPDNNDYFTHTLEGTDDMPAHIKASVLSSSIQIPITNGKLNLGTWQGIF
LCEHRNYGGSRRLVLTAFGI
NT seq 423 nt   +upstreamnt  +downstreamnt
atgaaattttatcaaaaagaaatacaattagagccttttaatagaggatttcacttaata
acacgtattattttaaatcaatttgaagagattggaaatattgaagttggtcaattacaa
gtttttataaagcatacttcagcaagtttaactattaatgaaaatgccgatagttctgtt
agaacagattttgaaaattattttaataggatagttccagataataacgattattttact
catacactagaaggtactgatgatatgccagcacatattaaagcatcagttttaagtagc
tctattcaaatacctattaccaacggaaaattaaatttaggaacttggcaaggaatattt
ttatgtgaacatagaaattatggaggttctcgtagattagttctcaccgcctttggaatt
tag

DBGET integrated database retrieval system