KEGG   Lipotes vexillifer (Yangtze River dolphin): 103070077Help
Entry
103070077         CDS       T03090                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00590  Arachidonic acid metabolism
lve01100  Metabolic pathways
lve04611  Platelet activation
lve04726  Serotonergic synapse
lve04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103070077 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103070077 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    103070077 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    103070077 (PTGS1)
Enzymes [BR:lve01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103070077 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 103070077
NCBI-ProteinID: XP_007468426
UniProt: A0A340Y3Z4
LinkDB All DBs
Position
Un
AA seq 622 aa AA seqDB search
MSRRSVSLRFLLLLLLLPPSPVLPAAPGSPAPAPVGKISLGEDLGHTSRSGESGVNPCCY
YPCQHRGICVRFGLDRYQCDCTRTGYSGPNCTIPELWTWLRTTLRPSPSFLHFLLTHGRW
FWEFVNATYIRDMLMRLVLIARSNLIPSPHTYNAAHDYISWESFSNVSYYTRILPSVPRD
CPTPMGTKGKKHLPDAELLSRHFLLRRQFIPDPQGSNLMFAFFAQHFTHQFFKTSGKMGP
GFTKALGHGVDLGHIYGDNLERQYHLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRG
IPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIG
ETIKIVIEEYVQQLSGYFLKLKFDPELLLGTQFQYRNRIAMEFNHLYHWHPLMPDSFWVG
PQNYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGQIGGGRNIDHHVLYVAVEVIKESREL
RLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCPPNSIF
GESMIEIGAPFSLKGLLGNPICSPEYWKSSTFGGEMGFNLVKTATLRKLVCLNTKTCPYV
SFHVPDPCQENGPGVGRPSTEL
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcggagtgtctcactccggttcctgctgcttctgctgctgctgccgccatcc
cctgtcctgccagcggcccccgggtcacccgcgccggccccagtggggaagatctccctc
ggtgaggacctgggacacaccagccgttccggagagagcggagtgaacccctgttgttac
tatccatgccagcaccggggtatctgtgtccgcttcggccttgaccgctaccagtgtgac
tgcacccgcacgggctattctggccccaactgcaccatccctgagctatggacctggctc
cggactactttgcggcccagcccctctttcctccacttcctgctgacgcatggccgctgg
ttctgggagtttgtcaatgccacctacatccgggacatgctcatgcgtctggtactcata
gcgcgttccaacctcatccccagcccccacacctacaacgcagcgcatgactacatcagc
tgggagtccttctccaacgtgagctactatacgcgtattctgccctctgtgccccgagac
tgtcccacgcccatggggaccaaagggaagaagcatttgccagatgccgagctcctgagc
cgtcacttcctgctcagaaggcagttcatccccgacccccaaggcagcaacctcatgttc
gccttctttgcacaacacttcacacatcagttcttcaaaacttctggcaagatgggtcct
ggcttcaccaaggctttgggccatggggtcgaccttggccacatttatggagacaatctg
gaacgtcagtatcacctgcggctctttaaggatgggaaactcaagtaccaggtgctggac
ggagagatgtacccgccatcggtggaagaggcgcctgtgctgatgcactacccccggggc
atcccgccccagagccagatggcagtgggccaggaggtgttcgggctgcttcctgggctc
atgctctacgccacactctggctgcgtgagcacaaccgagtgtgtgacctgctgaaggct
gagcaccccacctggggcgatgagcaactcttccagacggcccgcctcatcctcatcggg
gagaccatcaagattgtgatcgaggagtacgtgcagcagctgagtggctacttcctgaag
ctcaagttcgacccggagctgctgttaggcacacagttccagtaccgtaaccgaattgcc
atggagttcaatcacctctaccactggcacccgctcatgcccgactccttctgggtgggc
ccccagaactacagctatgagcagttcctgttcaacacctccatgctggtggactatggg
gtcgaggccctggtggacgccttctctcgccagcccgcgggacagatcggcgggggtagg
aacatagaccaccatgtcctatacgtggctgtggaagtcatcaaggaatcgagagagttg
cggctgcagcccttcaatgagtaccgtaagaggtttggcatgaagccctacacgtctttc
caagagctcacaggagagaaggagatggcagctgagctggaggagctgtatggagacatt
gatgccttggagttctacccagggctgcttcttgagaagtgccctccaaactccatcttt
ggggagagtatgatagaaattggggctcctttttcccttaagggcctcttagggaatcct
atctgttctccagagtactggaagtcgagcacgtttggcggtgagatgggtttcaacctt
gtcaagacggccacgctgaggaagctggtttgcctcaacaccaagacttgtccctacgtc
tccttccacgtgccggacccctgccaggagaatgggcctggagtggggcggccatccaca
gagctctga

DBGET integrated database retrieval system