KEGG   Lipotes vexillifer (Yangtze River dolphin): 103071263
Entry
103071263         CDS       T03090                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04060  Cytokine-cytokine receptor interaction
lve04066  HIF-1 signaling pathway
lve04151  PI3K-Akt signaling pathway
lve04630  JAK-STAT signaling pathway
lve04640  Hematopoietic cell lineage
lve05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103071263 (EPO)
   04066 HIF-1 signaling pathway
    103071263 (EPO)
   04151 PI3K-Akt signaling pathway
    103071263 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103071263 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103071263 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103071263 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lve04052]
    103071263 (EPO)
Cytokines and growth factors [BR:lve04052]
 Cytokines
  CSF and other factors
   103071263 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 103071263
NCBI-ProteinID: XP_007468903
UniProt: A0A340Y6N9
LinkDB
Position
Un
AA seq 192 aa
MGVRGCLLLLLLSSLLLSLGLPVLGAPPHLICDSRVLERYILEAREAENATMGCVEGCSF
SENITVPDTKVNFYAWKRMAVQQQAVEVWQGLALLSEAILQGQALLANSSQPSEALQLHV
DKAVSGLRSLTSLLRALGAQKGAVPLPDAASSAVPLRTFTVDTLCKLFRIYSNFLRGKLT
LYTGEACRRGDR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggtgcgcggatgtcttctgctgcttctgctgtcctcgttgctgctttctctgggc
ctcccagtcctgggcgcccccccacacctcatctgtgacagccgagtcctggagaggtac
atcctggaggccagggaggccgaaaatgccacgatgggctgtgttgaaggctgcagcttc
agtgagaacatcactgtcccagacaccaaggttaacttctatgcctggaagaggatggcg
gtccagcagcaggctgtggaagtctggcaaggtctggctctgctctcggaagccatcctg
cagggccaggccctgttggccaactcatcccagccatccgaggccctgcagctgcacgtg
gacaaagctgttagcggcctgcgaagcctcacctccctgcttcgggcgctgggagcccag
aagggagccgtcccccttccagacgcagcctcctctgcagtccccctccgaacattcact
gttgatactttgtgcaagcttttccgaatctactccaatttcctgcggggaaagctgacg
ctgtacacaggggaggcctgcaggagaggggacaggtga

DBGET integrated database retrieval system