KEGG   Lipotes vexillifer (Yangtze River dolphin): 103071508
Entry
103071508         CDS       T03090                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04060  Cytokine-cytokine receptor interaction
lve04061  Viral protein interaction with cytokine and cytokine receptor
lve04151  PI3K-Akt signaling pathway
lve04625  C-type lectin receptor signaling pathway
lve04630  Jak-STAT signaling pathway
lve04658  Th1 and Th2 cell differentiation
lve04659  Th17 cell differentiation
lve04660  T cell receptor signaling pathway
lve04672  Intestinal immune network for IgA production
lve04940  Type I diabetes mellitus
lve05135  Yersinia infection
lve05142  Chagas disease (American trypanosomiasis)
lve05162  Measles
lve05166  Human T-cell leukemia virus 1 infection
lve05200  Pathways in cancer
lve05320  Autoimmune thyroid disease
lve05321  Inflammatory bowel disease (IBD)
lve05330  Allograft rejection
lve05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    103071508 (IL2)
   04151 PI3K-Akt signaling pathway
    103071508 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103071508 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103071508 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103071508 (IL2)
   04660 T cell receptor signaling pathway
    103071508 (IL2)
   04658 Th1 and Th2 cell differentiation
    103071508 (IL2)
   04659 Th17 cell differentiation
    103071508 (IL2)
   04672 Intestinal immune network for IgA production
    103071508 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103071508 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103071508 (IL2)
   05321 Inflammatory bowel disease (IBD)
    103071508 (IL2)
   05330 Allograft rejection
    103071508 (IL2)
   05332 Graft-versus-host disease
    103071508 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103071508 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103071508 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103071508 (IL2)
   05162 Measles
    103071508 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    103071508 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lve04052]
    103071508 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:lve00536]
    103071508 (IL2)
Cytokines and growth factors [BR:lve04052]
 Cytokines
  Interleukins
   103071508 (IL2)
Glycosaminoglycan binding proteins [BR:lve00536]
 Heparan sulfate / Haparin
  Cytokines
   103071508 (IL2)
SSDB
Motif
Pfam: IL2 DUF773
Other DBs
NCBI-GeneID: 103071508
NCBI-ProteinID: XP_007464893
UniProt: A0A340XUF4
LinkDB
Position
Un
AA seq 154 aa
MYKMQLLSCIALTLALVANGAPTSSSTENTKKQVQSLLQDLHLLLKEINNYKNLKLFRML
TFKFYMPKKATELKHLQCLAEELKPLEDVLNVAQSKTQNSIDIKDLMDNINRIVLTLKGS
ETRFRCEYDDETVTAVEFLNKWITFCQSIYSTMT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaagatgcaactcttgtcttgcattgcactaactcttgcacttgtggcaaacggt
gcacctacttcaagctctacagagaacacaaagaaacaagtgcagtcattgctgcaggat
ttacatttgcttttgaaggaaattaataattacaagaacctcaagctcttcaggatgctc
acatttaaattttacatgcccaagaaggctacagaattgaaacatcttcagtgtctagca
gaagaactcaaacctctggaggatgtgctaaatgttgctcaaagcaaaacccagaactcg
atagatatcaaagatttaatggacaatatcaacagaatagttttgacactaaagggatct
gaaacaagattcagatgtgaatatgatgatgagacagtaactgctgtagaatttctgaac
aaatggattaccttttgtcaaagcatctactcaacaatgacttga

DBGET integrated database retrieval system