KEGG   Lipotes vexillifer (Yangtze River dolphin): 103075195Help
Entry
103075195         CDS       T03090                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve03030  DNA replication
lve03410  Base excision repair
lve03420  Nucleotide excision repair
lve03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:lve00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103075195 (LIG1)
   03410 Base excision repair
    103075195 (LIG1)
   03420 Nucleotide excision repair
    103075195 (LIG1)
   03430 Mismatch repair
    103075195 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lve03032]
    103075195 (LIG1)
   03400 DNA repair and recombination proteins [BR:lve03400]
    103075195 (LIG1)
Enzymes [BR:lve01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103075195 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     103075195 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103075195 (LIG1)
DNA replication proteins [BR:lve03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103075195 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103075195 (LIG1)
DNA repair and recombination proteins [BR:lve03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103075195 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     103075195 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     103075195 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR PucR
Motif
Other DBs
NCBI-GeneID: 103075195
NCBI-ProteinID: XP_007463357
UniProt: A0A340XT32
LinkDB All DBs
Position
Un
AA seq 921 aa AA seqDB search
MQRSIMSFFQPKKEGKVKNPENEISNSTRETESPPKVALKERNRVVPEGDSPVKRPGRKA
ARVLGSEGEDEEEEAPKPPKIQKLAPDSPQVSPPSPGTLPESSPSHSSTSPTVVSPSGIP
KRRTARKQLSKQTLQDVLQEQGKGEGRGAKKEEEEEEEEEELETPTESLTEPEGGNKKEA
EEGDQPRSPPEPLKTSTKPPTESVSEPKVAVKQGPQEDGQAKPSPKAPKTLSSFFSPRKP
AIKKEAKEEGPSALRKDETKGHLDPSSYNPAKSNYHPVEDACWKVGQRVPYLAVARTFEK
IEEVSARLRMVETLSNLLRSVAALSPADLLPVLYLSLNRLGPPQHGLELGIGDGILLKAV
AQATGRQLESVRAEAAEKGDVGLVAESSRSTQRLMLPPPTLTASGVFTKFRDIAQLAGSA
STAKKMDVIKGLFVACRHSEARFIARALSGRLRLGLAEQSVLAALAQAVSLTPPGQEFPP
AVVDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIVPVLLEHGVERLPEHCRLSPGV
PLKPMLAHPTRGVSEVLRRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGRY
PDIISRIHKIKLPSVTSFILDAEAVAWDREKKQIQPFQVLTTRKRKEVDAAEIQVQVCLY
AFDLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDTDQIAEFLEQSVKDS
CEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGF
LLAAYDEESEELQAICKLGTGFSDEELEEHHQSLQALVLPAPRSYVRADGAVAPDHWLDP
SAVWEVKCADLSLSPIYPAARGLVDSEKGISLRFPRFICVREDKKPEEATTSAQVACLYR
KQSQIQNQQGAEPESDLEDFY
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcagtattatgtcatttttccagcccaagaaagagggcaaagtgaagaaccca
gagaatgagatatccaacagcaccagagaaacagagtcccctccaaaggtggcgctgaag
gagcggaatagagtggtacctgagggcgactctccagtgaagaggccagggaggaaggcg
gcccgggtcctgggcagcgaaggggaggacgaggaggaggaagcccccaagccccccaaa
atccagaagcttgctccagattccccacaagtctcccctcccagtcctggcacactgcct
gagagcagcccttcccactctagcacctctcccacggtcgtctccccgtcagggatcccg
aagcgtcgcacggcccggaagcagctttccaaacagacacttcaggatgtcctgcaagag
cagggcaagggcgagggcagaggagccaagaaggaggaggaggaggaggaggaggaagaa
gaattagagacaccgacagaaagcctcacagagcctgaagggggcaacaagaaggaagca
gaagaaggggaccagcccaggtcaccccctgagcccctgaagacctccacaaagccccca
acagaaagcgtttcagagcccaaggtggccgtgaagcagggaccacaggaggacggccag
gctaagccttcccccaaagctcccaagacgctcagcagtttcttctctccccggaagcca
gcaatcaaaaaagaagcaaaagaagagggacccagcgccctgagaaaggacgagaccaag
ggacacctggacccatccagctacaatcctgccaagagcaactaccatcccgtcgaagat
gcttgctggaaggtgggccagagagtcccttacctggctgtggcccggacatttgagaag
attgaagaggtttctgcgcggctccggatggtggagacactgagcaacctcctgcgctcc
gtggcagccctgtcacctgctgacctcctccctgtcctctacctcagcctcaaccgcctg
gggccgccccagcatggcctggagctcggcattggcgacggcatcctcctcaaggcggtg
gcccaggccacaggccggcagctcgagtcggtccgggccgaggcagccgagaagggcgac
gtggggctggtggccgagagcagccgcagcacccagaggctcatgctgcccccgcccacc
ctcaccgcctccggcgtcttcaccaagttccgggacatcgcgcagctggccggcagcgct
tccacagccaagaagatggacgtcatcaaaggcctctttgtggcctgccgccactcagaa
gcacgattcatcgccagagccctgagtggacggctgcgcctcgggctggcagagcagtcg
gtgctggcggccctcgcccaggctgtgagcctcaccccgccaggtcaagaattcccccca
gccgtggtggatgctgggaagggcaagacagcagaggccagaaagacatggctggaggag
caaggcatgatcctgaagcagacgttctgcgaggtgcccgacctggaccggatcgtcccc
gtgttgctggagcacggtgtggagcggctcccggagcactgcaggctgagcccaggggtc
cccctgaaaccaatgttggcccacccaacccggggcgtcagcgaggtcctgaggcgcttt
gaggaggcagctttcacctgcgagtacaaatacgatgggcagagggcacagatccatgtt
ttggaaggaggggaggtgaagatcttcagcagaaatcaggaggacaataccggaaggtac
cccgatatcatcagccgcatccacaagattaaactcccatcagtcacatccttcatcctg
gacgcggaagccgtggcttgggaccgggaaaagaagcagatccagccattccaagtgctc
accacccgcaaacgcaaggaggtggacgcagcagagatccaggtgcaggtgtgtctgtac
gccttcgacctcatctacctcaatggagagtccctggtacgtgagcccctttcccgacgc
cggcagctgctccgggagaacttcgtggagacggagggcgagtttgtctttgccacctct
ctggacaccaaggacacggaccagatcgccgagttcttggagcagtcggtgaaagactcc
tgcgaggggctgatggtgaagaccctggatgtggacgccacctatgagatcgccaagagg
tcgcacaactggctcaagctgaagaaggactacctggacggcgtgggcgacaccctggac
cttgtggtgatcggcgcttacctgggccgggggaagcgggccggccgctacgggggcttc
ctgctggccgcctacgacgaggagagcgaggaactgcaggccatatgcaagctcggaacg
ggcttcagcgacgaggagctagaggagcatcaccagagcctccaggccctggtgctgccc
gccccacgctcctatgtccgggccgacggcgccgtggcccccgaccactggctggacccc
agcgccgtgtgggaggtgaagtgcgcagacctctccctctcccccatctacccggctgcc
cggggcctggtggatagcgagaagggaatctccctccgcttccctcggtttatctgcgtc
cgtgaggacaagaagccggaggaggccaccacaagtgcccaggtggcctgtctgtaccgg
aagcaaagtcagattcagaaccagcaaggcgcagagccagaatccgacctggaagatttc
tactag

DBGET integrated database retrieval system