KEGG   Lipotes vexillifer (Yangtze River dolphin): 103077265
Entry
103077265         CDS       T03090                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04060  Cytokine-cytokine receptor interaction
lve04068  FoxO signaling pathway
lve04144  Endocytosis
lve04218  Cellular senescence
lve04350  TGF-beta signaling pathway
lve04380  Osteoclast differentiation
lve04390  Hippo signaling pathway
lve04520  Adherens junction
lve04659  Th17 cell differentiation
lve04926  Relaxin signaling pathway
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve05142  Chagas disease
lve05161  Hepatitis B
lve05166  Human T-cell leukemia virus 1 infection
lve05200  Pathways in cancer
lve05202  Transcriptional misregulation in cancer
lve05210  Colorectal cancer
lve05212  Pancreatic cancer
lve05220  Chronic myeloid leukemia
lve05225  Hepatocellular carcinoma
lve05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103077265 (TGFBR2)
   04350 TGF-beta signaling pathway
    103077265 (TGFBR2)
   04390 Hippo signaling pathway
    103077265 (TGFBR2)
   04068 FoxO signaling pathway
    103077265 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103077265 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103077265 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    103077265 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103077265 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103077265 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103077265 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103077265 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103077265 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    103077265 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103077265 (TGFBR2)
   05212 Pancreatic cancer
    103077265 (TGFBR2)
   05225 Hepatocellular carcinoma
    103077265 (TGFBR2)
   05226 Gastric cancer
    103077265 (TGFBR2)
   05220 Chronic myeloid leukemia
    103077265 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103077265 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103077265 (TGFBR2)
   05161 Hepatitis B
    103077265 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103077265 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103077265 (TGFBR2)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     103077265 (TGFBR2)
Protein kinases [BR:lve01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   103077265 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 103077265
NCBI-ProteinID: XP_007455998
UniProt: A0A340X369
LinkDB
Position
Un
AA seq 567 aa
MGRGLLGGLWPLHIVLWTRIASTIPPHVPKSVNSDVMVTDDNGAVKLPQLCKFCDVRLST
CDSQKSCWSNCSITAICEKPQEVCVAVWRKNDENITLETVCHDPKIAYHGFVLDDAASAE
CIMKEKKGSGETFFMCSCSSEECNDHIIFSEEYATSNPDLLLVIFQVTGVSLLPPLGIAI
AVIVTFYCYRVHRQQKLSPAWDSGKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLRQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRRLGGSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKGDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCSAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMVCETLAECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSSSEEKIPEDGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggccgggggctgctcgggggcctgtggccgctgcacatcgttctgtggacacgcatc
gccagcacgatcccgccgcacgttcccaagtcggttaacagtgacgtgatggtcactgac
gacaatggtgccgtcaagttgccgcagttgtgtaaattctgtgatgtgagattgtccacc
tgtgacagccagaagtcctgctggagcaactgcagcatcacggccatctgtgagaagccg
caagaggtctgcgtggctgtctggagaaagaatgacgagaacatcacactggagacggtc
tgccatgaccccaagatcgcctaccatggatttgtccttgacgacgctgcttctgcagag
tgtattatgaaggaaaaaaaggggtctggagagactttcttcatgtgttcctgcagctcc
gaagagtgcaacgaccacatcatcttctccgaagaatacgccaccagcaaccccgacttg
ctgttggtcatcttccaagtgacaggtgtcagcctcctgccgccgctgggcatcgccatt
gccgtcattgtcaccttctactgctaccgcgtccaccggcagcagaagctgagcccggcc
tgggactcaggcaagccgcgcaagctgatggagttcagtgagcacctggccatcatcctg
gaggatgaccgctccgacatcagctccacctgcgccaacaacatcaatcacaacacggag
ttgctgcccattgagctggacaccctggtgggcaaagggcgcttcgccgaggtctacaag
gccaagctgaggcagaacacgtctgagcagtttgagaccgtggccgtcaagatcttcccc
tatgaagaatacgcctcctggaagacggagaaagacatcttctcggacatcaacctcaag
cacgagaacatcctgcagttcctgacagctgaggagcgcaagacggagctgggcaagcag
tactggctgatcaccgccttccacgccaagggcaacctgcaggagtacctgacgcgccac
gtcatcagctgggaggacctgcgcaggctgggcggctcgctggcccgtggcatcgcgcac
ctgcacagcgaccacacgctgtgcggccgacccaagatgcccatcgtgcacagggacctc
aagagctccaacatcctggtcaagggagacctcacctgctgcctctgtgacttcggcctc
tccctgcggctggaccccactctgtctgtggatgacctggccaacagtgggcaggtggga
acggcgagatacatggctccagaggtcctagagtccaggatgaatctggagaatgtcgag
tccttcaagcagacagatgtctactccatggccctggtgctctgggagatgacgtctcgc
tgcagcgcagtgggagaagtgaaggattatgagcctccattcggttccaaggtgcgggag
catccctgtgtcgaaagcatgaaggacaacgtgttgagagatcgaggacgacccgaaatc
ccaagctcctggctcaaccaccagggcatccagatggtgtgtgagacgctggccgagtgc
tgggaccacgaccccgaggcccggctcacggcgcagtgtgtggccgagcgcttcagtgag
ctggagcatctggacagactctcgggcaggagcagttcggaggagaagattcccgaagac
ggctccctgaacactaccaaatag

DBGET integrated database retrieval system