KEGG   Lipotes vexillifer (Yangtze River dolphin): 103083417
Entry
103083417         CDS       T03090                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04060  Cytokine-cytokine receptor interaction
lve04151  PI3K-Akt signaling pathway
lve04210  Apoptosis
lve04630  JAK-STAT signaling pathway
lve04640  Hematopoietic cell lineage
lve05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103083417 (IL3RA)
   04151 PI3K-Akt signaling pathway
    103083417 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103083417 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103083417 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103083417 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103083417 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:lve04050]
    103083417 (IL3RA)
   04090 CD molecules [BR:lve04090]
    103083417 (IL3RA)
Cytokine receptors [BR:lve04050]
 Interleukin receptor families
  IL3 receptor family
   103083417 (IL3RA)
CD molecules [BR:lve04090]
 Proteins
  103083417 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind Y_Y_Y Levi_coat
Other DBs
NCBI-GeneID: 103083417
NCBI-ProteinID: XP_007460554
UniProt: A0A340XMN8
LinkDB
Position
Un
AA seq 385 aa
MAFVWLAVFLVPTSGLLPPDHDPYPIDISDPDPPIKNLRMEPERKRLTWDLHGNVSEIMC
FINSKAFTKARKRTYCSIPDLSCQATNYSIKVTKGQPFSTWIQYPSQEGNPRAAAENLTC
WVHDVDFLTCSWAVGREAPRDVQYNLYLENLDSYEKWPCSQYRADEQGTNVQCRFHNISV
LSKDQTRFLVNGTSSGSKIPCSETSDRLAKIEVLAAPDITTRWCNQSYSFMQWQVRSHLN
DDFKYELQIQKGMELAYKQEIYKAFLELKNPGTYTVQVRARDATFSHYKPWGPWSVPQHF
VCEEGARLPVWLTSLLIALGTLLAMGLGLRFCRFSVMQKLFPPIPHMKDHINGKLQNGRT
MTWDSWDQDSQEECPVAEVQVLGET
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggctttcgtctggctggcggtcttcctggtgcccacctccggactgctgccaccggac
cacgacccttaccctatagacatttccgatccagacccaccaattaagaacctaaggatg
gagccagaaagaaaaagattgacctgggacctccacggaaacgtttccgaaattatgtgt
ttcatcaattcaaaagctttcactaaggcacggaaaaggacgtattgcagtattcctgac
ttgtcatgccaagctacaaactacagcatcaaggtgaccaaaggtcagccattctccacg
tggattcagtatcctagtcaagaagggaatcccagggcggctgcagaaaacctgacctgc
tgggttcacgacgtggatttcctgacgtgcagctgggcggtgggccgggaggccccaagg
gacgtgcagtacaatctctatctggagaacctggactcctatgagaagtggccgtgctcc
cagtacagagcagatgagcaagggacaaacgtccagtgccgttttcacaacatctctgtg
ttatccaaggatcagacgcgtttcctggtgaatggcaccagcagtggttccaaaatcccc
tgctctgaaacaagtgacagattagccaaaatcgaggtattagctgctcccgacatcact
accaggtggtgtaaccaaagctactcgttcatgcagtggcaagtgaggagtcaccttaat
gatgacttcaagtatgaacttcagatacagaagggtatggagctcgcctacaaacaggag
atctataaagccttcttggagctgaaaaatcctgggacctacacagtgcaagtaagggcc
agggatgccaccttctctcattacaaaccttggggcccgtggagtgtcccccaacacttc
gtgtgtgaggagggcgcgcgcctccccgtctggctgacgtctttgctgatcgcgctgggg
acgctgctggctatggggctcgggctccggttttgcaggttctcggtgatgcagaagctg
ttccctcccatccctcacatgaaagaccatatcaatggcaaacttcagaacggaaggacg
atgacctgggactcctgggaccaagacagccaggaggagtgtccagtggccgaggtgcag
gttctgggggaaacgtga

DBGET integrated database retrieval system