KEGG   Lipotes vexillifer (Yangtze River dolphin): 103086103
Entry
103086103         CDS       T03090                                 

Gene name
LHB
Definition
(RefSeq) luteinizing hormone beta polypeptide
  KO
K08521  lutropin subunit beta
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04024  cAMP signaling pathway
lve04080  Neuroactive ligand-receptor interaction
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04917  Prolactin signaling pathway
lve04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    103086103 (LHB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103086103 (LHB)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    103086103 (LHB)
   04912 GnRH signaling pathway
    103086103 (LHB)
   04913 Ovarian steroidogenesis
    103086103 (LHB)
   04917 Prolactin signaling pathway
    103086103 (LHB)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 103086103
NCBI-ProteinID: XP_007463400
UniProt: A0A340XW69
LinkDB
Position
Un
AA seq 141 aa
MEMLQGLLLWLLLSVAGVWAPRGPLRPLCRPINATLAAENEACPVCITFTTSICAGYCPS
MVRVLPAALPPMPQPVCTYRELRFASIRLPGCPPGVDPTVSFPVALSCHCGPCRLSSSDC
GGPRAQPLACDRSPRPGLLYL
NT seq 426 nt   +upstreamnt  +downstreamnt
atggagatgctccaggggctgctgctgtggctgctgctgagcgtggccggggtgtgggca
cccagggggccactgcggccgctgtgccggcccatcaacgccaccctggccgctgagaat
gaggcctgccctgtctgcatcaccttcaccaccagcatctgtgccggctactgccccagc
atggttcgggtgctgccggctgccctgccgcctatgccgcagccagtgtgcacctaccgc
gagctgcgctttgcctccatccggctccccggctgcccgcctggtgtggacccaacggtt
tccttccccgtggccctcagctgtcactgcgggccctgccgcctcagcagctctgactgt
gggggtcccagagcccagcccttggcctgtgaccgctcccctcgcccaggcctcctctac
ctctaa

DBGET integrated database retrieval system