KEGG   Lipotes vexillifer (Yangtze River dolphin): 103091628
Entry
103091628         CDS       T03090                                 

Gene name
ELK1
Definition
(RefSeq) ELK1, ETS transcription factor
  KO
K04375  ETS domain-containing protein Elk-1
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04012  ErbB signaling pathway
lve04014  Ras signaling pathway
lve04510  Focal adhesion
lve04910  Insulin signaling pathway
lve04912  GnRH signaling pathway
lve04921  Oxytocin signaling pathway
lve05140  Leishmaniasis
lve05161  Hepatitis B
lve05163  Human cytomegalovirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05200  Pathways in cancer
lve05205  Proteoglycans in cancer
lve05213  Endometrial cancer
lve05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103091628 (ELK1)
   04012 ErbB signaling pathway
    103091628 (ELK1)
   04014 Ras signaling pathway
    103091628 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103091628 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103091628 (ELK1)
   04912 GnRH signaling pathway
    103091628 (ELK1)
   04921 Oxytocin signaling pathway
    103091628 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103091628 (ELK1)
   05205 Proteoglycans in cancer
    103091628 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103091628 (ELK1)
   05213 Endometrial cancer
    103091628 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103091628 (ELK1)
   05161 Hepatitis B
    103091628 (ELK1)
   05163 Human cytomegalovirus infection
    103091628 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    103091628 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lve03000]
    103091628 (ELK1)
Transcription factors [BR:lve03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    103091628 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 103091628
NCBI-ProteinID: XP_007450918
UniProt: A0A340WV24
LinkDB
Position
Un
AA seq 444 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTVANVGTTAVH
AIPGDTASGKPGTPRGAGVAGPGGLARSSRNDYMRSGLYSTFTIQSLQPQPQPQPPSHPR
PSTVLPNTAPAGAAVPPSGGRSTSPSPLEACLEAEEAGLPLQVILTPPVAPNLKSEEPNM
EPGLGRPLPPEVKVEEPKEELEAAATGEAGFVLEAVKAEPFEPKAEPEAPPAEGVPARLP
AVVMETAAPVGGLAASTTSSTEIAQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGTGSG
LQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQ
VHIPSISVDGLSTPVVLSPGPQKP
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggacccttctgtgacactgtggcagtttctgctgcagctgttgagagagcaaggcaat
ggccacattatctcctggacctcccgggatggtggtgagttcaagctggtggatgctgag
gaggtggcccggctctgggggctgcgcaagaataagaccaacatgaattatgacaagctc
agccgggccttgcggtactactatgataagaacatcatccgcaaagtgagtggccagaag
ttcgtctacaagtttgtgtcctaccccgaggtcgcggggtgctccactgaggactgcccg
ccccagcctgaggtgtctgtcacctccactgtggcaaatgtgggcaccacagctgtacac
gccatccccggggacactgcctctgggaagccaggcacacccaggggtgcaggagtggca
ggcccaggcggcttggcgcgcagcagccggaatgattacatgcgctcgggcctctattcc
accttcaccatccagtccctgcagccgcagccacagccacagccaccctctcatcctcgg
ccttccacagtgctccccaacaccgcccctgcaggagcagcagtgcccccctcggggggc
aggagcaccagtccaagccccttggaggcctgcctggaggctgaggaggccggcctgcct
ctgcaggtcatcctgaccccacccgtggccccaaaccttaaatccgaagagccaaatatg
gagcctgggttgggccggccactgcccccagaagtcaaagtggaagagcccaaggaagag
ttagaagccgcagccactggggaggcggggtttgtcctggaagccgtcaaggccgagccc
tttgagcccaaggccgagccagaagccccgcccgcggagggcgtgccagcccggctgcct
gcggtcgttatggaaactgcggcgccggtgggcggccttgcggcttccacaacttccagc
acggagatcgcccagcctcagaagggccggaagccccgggacctggagcttccactcagc
ccgagcttgctgggtgggccgggacccgaacggactccaggatcgggaactggttccggt
ctgcaggcgccaggcccagcgctgacgccttccctgctacctacgcacacattgaccccg
gtgctgctgacgcccagctcgctgccccccagcattcatttctggagcaccctgagtccc
attgcaccccgtagcccggccaagctctccttccagtttccgtccagtggcagcgcccag
gtgcacatcccttccatcagcgtggatggcctctcaacccccgtggtgctctccccaggg
ccccagaagccatga

DBGET integrated database retrieval system