KEGG   Mycobacteroides abscessus subsp. bolletii 50594: MASS_4472Help
Entry
MASS_4472         CDS       T02682                                 

Definition
(GenBank) transmembrane serine/threonine-protein kinase PknQ
Organism
mabb  Mycobacteroides abscessus subsp. bolletii 50594
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like APH Kdo
Motif
Other DBs
NCBI-ProteinID: AGM31074
UniProt: R4UT03
LinkDB All DBs
Position
4478400..4480178
Genome map
AA seq 592 aa AA seqDB search
MTSSDRSSPGPGSQQPGDLPPGTVVSGYQIERVLGRGGMGTVYLAANPNLQRSEALKILS
AQSSRDPEFRARFMREASLAASLDHPNIVTVHNRGETPEGDLWIAMQYVQGSDAHSESAG
GRMSLTRAVHIISEVAKALDYLHARGLVHRDVKPANILLSAGDRRIMLGDFGLTRALDDS
NSVTSAGNVTATIAYAAPEILSGTAVDGRADVYALGCTLFRMLTGQPPFGSGNSLPAIIN
AHLSAPPPRISQFASVPESWDALIAKAMAKTPADRYQSAGELALAAQQILTDPAQHRQTV
TQPVPATTPAAIAAAEPVHAMAPLAMADTGQSMLKHKRIAAIIGVMVLVVASSVVAVLIW
PRADEQTDPRTKASPSSAQVAPGASLAGQPNTVLDTLLPGQFDYPEGWEKNPSPTFRSGE
FNPAVPPGSATNIGGTPVGCNTIDPVWALRAKGRETSTLYLRDRKKPEREIMIRVVPAAD
ALSTDGASDALKRCDAVAYIIPGSSTTWRCSFEFDEPNPVQNGQKELTTTESCYMFPSGA
NSIRQHVSFNVVRGLLVYILASGASNRNDAAGSLSATALSFATTMKILRYGR
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcatcggatcgatcctcaccgggtccgggtagccagcaacccggcgacctgcca
ccggggaccgtcgtatccggctaccagatcgagcgtgtcctcggacgcggcggcatgggg
actgtgtatctggccgccaacccgaacctgcagcgttccgaggccctcaagatcctcagc
gcccagtcctcacgcgaccccgagttccgggcacggtttatgcgcgaggcatcgctcgcc
gcatccctggaccaccccaatatcgtcacggtgcacaaccgcggagaaacaccggagggt
gacctgtggatcgcgatgcagtacgtccagggcagcgacgcgcattcggagtccgcgggt
gggcgcatgtcgttgactcgtgctgttcacatcatcagcgaggtcgccaaggcactcgat
tacctccacgcccgcggactggtacaccgcgacgtgaagcccgccaacattctcctatct
gcgggtgatcgtcggatcatgttgggcgacttcggccttacccgggcactcgatgacagc
aacagcgtcacgtcggcggggaatgtgaccgccaccatcgcatacgcggcaccagaaatc
ctgtccggcacggcggtcgatgggcgtgccgacgtctatgccttgggctgcacgctcttt
cgcatgttgacgggccagccgcccttcggctcgggcaactcactgccggcgatcatcaac
gcacacctttccgcgccgccgccgcggatatcgcaattcgcctcggtacccgaatcatgg
gacgcgttgattgccaaagcaatggccaagactcctgccgatcggtaccaaagcgccggg
gagcttgcgttggccgcccagcagatcctgacggatccggcacagcaccggcagacggtg
acccaaccggtgccggccacgactcccgcggccatcgcagcagcagagccggtgcacgcg
atggcacccctcgccatggccgacacggggcaatccatgctcaaacacaagcgaattgcg
gccatcatcggcgtcatggtgctggtagtcgcgtcgtccgtggttgcggtcctgatatgg
ccgcgggccgacgaacagaccgatccccgaaccaaagccagccctagctccgcccaggta
gcacccggcgcatcattggccgggcaacccaataccgtgctggacaccttgctgcccggg
cagttcgactaccccgaggggtgggagaagaatccatcgcccaccttcagatcgggcgag
ttcaatcccgccgtaccgcccggatctgccaccaatatcggcggaacacccgtgggctgc
aacaccattgatcccgtctgggcactgcgcgcaaaggggcgtgagacgtcgacgctatac
ctgcgggaccgtaagaagccggaacgcgaaatcatgatccgagttgtcccggcggccgat
gctctgtccacggacggcgcctccgatgcgctgaaaaggtgcgacgcggttgcgtacatc
atccccggcagcagtaccacctggcgatgctcgttcgaattcgatgagccgaaccccgtt
caaaatggccagaaagagctcactaccacggaatcctgctacatgtttccgtcaggagcg
aacagcattcggcagcacgtgtccttcaacgtcgtgcgcggactgctcgtgtacatcctg
gccagcggtgcctccaatcgaaacgacgcggcaggctcactcagcgcaactgcgctgagt
tttgcgaccaccatgaaaatcctgcgctacggccgctaa

DBGET integrated database retrieval system