KEGG   Marinobacter adhaerens: HP15_2853
Entry
HP15_2853         CDS       T01922                                 

Gene name
gtfA
Definition
(GenBank) sucrose phosphorylase
  KO
K23079  glucosylglycerol phosphorylase (configuration-retaining) [EC:2.4.1.359]
Organism
mad  Marinobacter adhaerens
Brite
KEGG Orthology (KO) [BR:mad00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HP15_2853 (gtfA)
Enzymes [BR:mad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.359  glucosylglycerol phosphorylase (configuration-retaining)
     HP15_2853 (gtfA)
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: ADP98617
UniProt: E4PMA5
LinkDB
Position
2993679..2995121
AA seq 480 aa
MLLKNAVQLICYPDRIGNNLKDLYTVVDTHLSEAIGGLHILPFFPSNADGGFSPLTHKEV
DPKVGTWDDIEAFTAKYDLCVDLTVNHISDESPEFTDFIANGFDSEYADLFVHVDKFGEI
SPDDMAKIHIRKEKEPFREVTLSDGTKTRVWCTFTEQQIDLNYESDLAYQLMESYIGFLT
SKGVNLLRLDAFGYTTKRIGTSCFLVEPEVYQILDWVNQVALKHGAECLPEVHDHTSYQY
AISRRNMHPYGFALPPLLLYSLLDANSTYLKNWLRMCPRNMVTVLDTHDGICIPDVEGVL
PDEKIKVLIDNIDARSADPIMRRSAANIHSVGAIYQLTCTFYDALMQNDDAYIAARAIQF
FTPGIPQVYYVGLLAGCNDHELMEQSGELRDINRHYYTLEEVEQDIQKPVVQRLLSLMKF
RSNYPAFDGHFELNYSNNSSVAMAWRHGDYYCHLFVDLNFKTVKVTYTDVETGETRHLEC
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgttgctcaaaaatgcggtgcagctgatctgttatccggaccggatcggcaacaatctg
aaagacctttacaccgtggtggacacgcatctgtccgaagccatcggcgggctgcacatc
ctgccgttttttccctccaacgccgatggcggcttctcgccgctgacccacaaggaagtg
gacccgaaggtgggcacctgggacgacatcgaagcctttacggcaaagtacgatctgtgc
gtggatctgacggttaatcatatctcggacgaatcgccggagttcaccgacttcattgcc
aacggcttcgactcggaatacgccgatctgtttgtgcacgtggacaaattcggcgagatc
tcaccggacgacatggcgaagattcacatccgcaaggagaaggaacccttccgggaagtg
accctgtccgacggcaccaaaacccgagtgtggtgtaccttcaccgagcagcagatcgac
ctgaattacgaatccgacctggcctatcagctgatggaaagctacatcggatttctgacg
tcaaaaggggttaatctgctgcggctggacgccttcggatacaccaccaaacggatcggc
accagctgctttctggtggaaccggaggtgtatcagatcctcgattgggtcaaccaggtt
gccttgaaacacggggcggaatgcctgccggaagtacacgaccacaccagctaccagtac
gccatcagccggcgcaacatgcacccctacggctttgccctgccgccgctgctgctctat
tcactgctggacgccaacagcacctacctgaagaactggctgcgcatgtgcccgcgcaac
atggtcaccgtgctggatacccatgacggcatctgcattcccgatgtggaaggcgttttg
ccggatgagaaaatcaaagtactgatcgacaacatcgacgcccgcagcgcggaccccatc
atgcggcgctcagcggccaacattcacagcgtgggtgccatctatcagctcacctgcacc
ttttatgacgcgctgatgcaaaacgacgacgcctacatcgccgcccgggccatccagttt
ttcaccccgggcatcccacaggtttactacgtggggctactggccggctgtaacgatcac
gagctgatggaacaaagtggcgagttgcgagacatcaaccgccattactacaccctcgaa
gaagtggagcaggacatccagaaaccggtggtacaacgcctgctaagcctgatgaagttc
cgcagcaactacccggcctttgatgggcacttcgaactgaactattccaacaactcaagc
gtggccatggcctggcgccatggagactattactgccacctgtttgtagacctgaacttc
aaaaccgtgaaggtcacttacaccgatgtggaaacgggggaaacccgacacctggagtgc
tga

DBGET integrated database retrieval system