KEGG   Marinobacter adhaerens: HP15_3134Help
Entry
HP15_3134         CDS       T01922                                 

Definition
(GenBank) two-component system sensor protein
Organism
mad  Marinobacter adhaerens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg HisKA PAS_9 PAS_8 PAS HATPase_c_2 HATPase_c_3 Glyco_trans_4_3 NPFF
Motif
Other DBs
NCBI-ProteinID: ADP98898
UniProt: E4PPM7
LinkDB All DBs
Position
complement(3285829..3287595)
Genome map
AA seq 588 aa AA seqDB search
MKKPSDSKDGEQDSSYGIGDLLGLGSQSVRKNYYPALQERIDELEQERNRYKWLFENALH
GIFQANLRGGFLACNPAMARICGYDSPEALTEKVIRLREQLFCSSSEFDAIRQELLDEGS
LSARETRFQRADRTPVHVAVTLLRRPDLGPEVVEAFVADITERVLARQKLEQLNATLERR
VEERTEALQNANVGLRYQIEEREKVERELFVAMEAAKEANRSKDKYLAAASHDLLQPLNA
ARLMISALQDSTLPEQETRMVHQVHRALEGAEDLLADLLDISKLDQQAMKPDLVYTDVAA
LARSLGEEFEAVASNAGLGFRVRTIPAMVRTDQRMLTRILRNLLSNAFRYTRKGGVVMAL
RSRGDRLRIEVWDTGVGIEEDKLRDIFTEFHQLLPQGTGGRQGVGLGLAIVERMVRVLGY
DIDVSSRPGRGSRFVLTLPLEPAQARPDMARTDSLQNFADGFDGVPVLVIDNEPAVLESM
QLLLERWGCDVLTAASKAEAVEALEQTGQIPALILADYHLNNERTGYDAVHGVRRYLGKN
IPAAIITADRSDDTRKLLRAQELPILNKPVKPNRLRALMTSLLTSASA
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagccctctgacagcaaggatggcgaacaggacagtagctacggaattggcgat
cttctcgggctgggcagccagtccgtccgcaagaactattacccggctctgcaggaacgc
attgacgagctggagcaggaacgcaaccgctacaaatggctgttcgagaacgcgctgcac
ggtatcttccaggccaacctgcggggcggctttctggcctgcaacccggcgatggcgaga
atctgcggttatgacagccccgaggcgctcacggaaaaggtcatccggctccgtgaacag
ttgttctgcagttccagtgaattcgatgccatacgtcaggagcttctcgacgagggcagt
ctgagtgcccgggaaacccgtttccagcgtgctgatcgcacgccggtccacgttgctgtc
accctgctgcgacgcccggacctcggaccggaagtggtggaagccttcgttgccgacata
accgagcgagtgttggcccggcagaaactggagcagttgaacgccacccttgagcggcgc
gtggaagagcggaccgaagcattgcagaatgccaatgtgggcctgcgctaccagattgag
gagcgcgagaaggttgagcgcgagctctttgttgccatggaagccgccaaagaggccaac
cgcagcaaggataaatatctcgcggcggccagccatgacctgctccagcccctgaatgca
gcccggctgatgatatccgcgctccaggacagcacgctgccggaacaggaaacccgcatg
gtgcaccaggtacatcgggcactggagggcgccgaagacctgctggcggacctgctggat
atctccaagctcgaccagcaggcaatgaagcctgatctggtttataccgatgtagccgcc
ctggccagatccctcggggaggagttcgaggccgttgccagcaatgccggcctcgggttc
cgggtacgcaccattccggcgatggtacgaacagatcagcgcatgctgacccgtatcctc
cgaaatcttctcagcaatgccttccggtacacccgcaagggcggtgttgtcatggcgttg
agatcccgcggcgaccgtctgcggattgaagtctgggacaccggtgttggcatcgaggaa
gacaagctccgggacattttcaccgagtttcaccagctgttgccccagggcaccggcggc
cggcagggcgtgggcctggggctggccatcgtggaacggatggtccgggtgctggggtac
gacattgatgtgtcatcacggcccggtcgtggctcccgcttcgtgctgaccctgccgctt
gaacccgctcaggccagaccggatatggcccgtacagattcgctccagaatttcgccgat
ggctttgacggtgtgccggtgctggtgatcgacaacgagccggcggttctggagagcatg
cagttgctgctggagcgttggggctgtgatgtgctcacagccgccagcaaggcagaggcc
gtggaggctctcgagcaaaccggccagataccggcccttatccttgcggactatcacctg
aacaatgagcgaaccggttacgatgcagttcacggggttcgccgttaccttggcaagaat
attcccgccgccattatcactgcagatcgtagcgacgacacccgcaaactccttcgggcc
caggaactgcccatcctgaacaagcctgtgaagccgaaccggctcagggctctgatgacc
agcttgctgacttctgcctcggcctga

DBGET integrated database retrieval system