KEGG   Monopterus albus (swamp eel): 109957388
Entry
109957388         CDS       T05607                                 

Definition
(RefSeq) serine/threonine-protein kinase Chk2-like isoform X1
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109957388
   04115 p53 signaling pathway
    109957388
   04218 Cellular senescence
    109957388
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109957388
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:malb03400]
    109957388
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109957388
Protein kinases [BR:malb01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   109957388
DNA repair and recombination proteins [BR:malb03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109957388
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Kinase-like Kdo RIO1 YrbL-PhoP_reg APH Pkinase_fungal Yop-YscD_cpl FTA2
Other DBs
NCBI-GeneID: 109957388
NCBI-ProteinID: XP_020450902
LinkDB
Position
Unknown
AA seq 566 aa
MSLLKCKYPVWSPGDAAIQSQQKLQKNWRMSEEVPHEGDQSQSSEFQSPSQTQSTLSPSQ
AQSTQLPSQAQSPSQSKSQSQPGSSSSSGPTSGSQSSSGSGTLSSMDTIPVTLPSVPEEP
EPQPWGRLLPMARGFRSLDCIEDQYLFGRGSNCNYVLDDPDDRGSNKFRIYSKKHFRIFR
EGSEVFVEDYSNNGTFVDGLLIGKNKRQPLVNNAVLALAEQRNKVFVFIDLISDDQSSLP
KELQEKYLLTRRIGTGVCGEVKLAFERSNCKKFAVKVINKKNFQSEGTATRNAETEIEIL
QRIDHPCLIKTEDFYQTDDSYYIVLELMEGGELFHRVKSQQQLHEAIAKLYFYQMLKAVQ
YLHSNGIIHRDLKPENILLSSQDDVCLIKVTDFNQSRILEEAMLMRTLCGTPSYLAPEVF
THASTTGYGLAVDAWSLGVLLFVCLGGYPPFHESFGPQSTIDQIIRGEFTMVQSKWKHVS
DQAKDVVRKLLVVDPSKRITIDEALQHPWLQDRAMMETAHTLMYPPGDAAATMVAGLATG
RKRVRDGDEEEEQPAKRSQAPPPAQL
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgtctttgttaaaatgtaaatatcctgtctggtccccaggagatgcagccatccagtct
cagcagaagttacagaaaaactggagaatgtctgaagaggttccacatgagggggaccaa
tcccagtcctctgagttccagtccccatcccagacccagtccaccctctccccgtcccag
gcccagtctacccagttgccatcccaggcccagtccccatcacagtccaagtcccagtcc
cagcctggttccagctcttctagcgggccgacctcaggaagccagtcatccagtggctct
gggactctgagcagcatggacaccatccccgtcactctgccgtctgtcccagaagagccc
gaaccacaaccctggggccgcctgctgcccatggctcgaggcttcaggagcctcgactgc
atcgaggatcagtacctgtttggacgaggctctaactgtaactatgtcctggatgatcct
gatgatcgaggatccaataagttcagaatctacagcaagaaacacttcaggatcttcaga
gagggcagtgaagtgtttgtggaggactacagtaacaacggcacatttgttgacgggctc
ctgatcggtaaaaacaagaggcaacccctggtcaacaacgctgtgctcgcgctggctgaa
cagcgcaacaaagtgtttgtcttcattgatctgatatctgatgatcagtccagtttacct
aaagagctgcaggagaaatatctgctgactcgacgcattggcacaggcgtgtgtggtgaa
gtcaaactggccttcgagagatcaaactgtaagaaatttgcagtgaaagtaataaacaag
aagaactttcagtctgaagggacagccacacgaaatgctgagacagagatagagattctc
cagaggatcgaccatccatgtctcataaagacggaggacttctaccagacagatgacagt
tactacattgtgttggagttgatggaggggggtgaactgttccacagagtgaagtctcag
cagcagctccacgaggccatcgccaaactttacttctaccagatgctcaaagctgtccag
tacctccacagtaatggcatcatccacagagacctgaagccagagaacatcctgctgtcc
tcacaagacgacgtctgtctcatcaaggtgacggactttaaccagtccaggatcctggag
gaggccatgctgatgagaactctatgtgggacgccgtcatacctggcgcctgaagtcttc
acccacgcctccaccacagggtacggcctcgccgtggacgcatggagcctcggagtcctg
ctctttgtctgtctgggtggttatcctccatttcatgagagttttggtcctcagtcgacc
atagatcagatcattcgaggagaattcaccatggttcagtccaagtggaaacacgtctct
gaccaagcaaaggatgtggtgaggaagctgttggttgttgatccaagtaagaggattact
atagacgaggctctgcagcacccctggttacaggaccgtgcgatgatggagacagctcac
acactcatgtacccgcctggagacgctgctgccaccatggtggcggggttagccactggg
aggaaacgagtgcgagatggagacgaggaagaggaacagccggccaaacgaagccaagcc
ccgccccctgcccagctgtag

DBGET integrated database retrieval system