KEGG   Monopterus albus (swamp eel): 109959975
Entry
109959975         CDS       T05607                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109959975 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109959975 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:malb04052]
    109959975 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:malb00536]
    109959975 (fgf1)
Cytokines and growth factors [BR:malb04052]
 Growth factors
  Growth factors (RTK binding)
   109959975 (fgf1)
Glycosaminoglycan binding proteins [BR:malb00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   109959975 (fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 109959975
NCBI-ProteinID: XP_020455432
LinkDB
Position
Unknown
AA seq 181 aa
MISEHGGFPLSLQAQGHHSASSELQTLCRMSEGDVTVLPLGLASLSLSRQEHQMLKRLYS
WNGGYHLRILPDGSVTGGRQENDPYDILKLKAVSVGVVVIKGEKTGRYFAMNKNGHLYGS
QELNDECYFLEKYEENHYSTYRSQKYNWYVALKRNGQPKAGPDTHQGQKAIFFLPRPAGN
M
NT seq 546 nt   +upstreamnt  +downstreamnt
atgatcagtgaacacggtggctttcctctgtcgttgcaggcacagggacatcactctgct
tcatccgagcttcaaactctctgtaggatgtctgagggagatgttacagtgctcccactg
ggacttgcctctctgtccctgtccaggcaggagcaccagatgctgaaaaggctctacagc
tggaatggaggatatcacctgaggattttaccagatggaagtgtgactggtgggaggcag
gaaaatgatccttacgacatcctcaagcttaaggcagtgagtgtgggagtggtggtcatt
aagggtgagaagacaggaaggtacttcgccatgaacaaaaacgggcacctctatggatca
caagaactgaatgatgagtgttacttccttgagaagtatgaagaaaaccactacagcaca
tatcgctctcagaaatacaactggtatgttgcactgaagaggaacggacaacctaaagca
ggaccagacacccaccagggtcagaaggccatcttcttcctgccaaggcctgcaggcaac
atgtaa

DBGET integrated database retrieval system