KEGG   Monopterus albus (swamp eel): 109969614
Entry
109969614         CDS       T05607                                 

Gene name
atr
Definition
(RefSeq) serine/threonine-protein kinase ATR isoform X1
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb03460  Fanconi anemia pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:malb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    109969614 (atr)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109969614 (atr)
   04115 p53 signaling pathway
    109969614 (atr)
   04218 Cellular senescence
    109969614 (atr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109969614 (atr)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:malb03400]
    109969614 (atr)
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109969614 (atr)
Protein kinases [BR:malb01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   109969614 (atr)
DNA repair and recombination proteins [BR:malb03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109969614 (atr)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC HEAT HEAT_2 Perilipin V-ATPase_H_C DUF2913
Other DBs
NCBI-GeneID: 109969614
NCBI-ProteinID: XP_020472290
LinkDB
Position
Unknown
AA seq 2611 aa
MEGLEMSAMIPALQELASVSAAQYEQAVQKPRQILCQFIDRILTDVDVVALGLSKKSSSD
PACVMLLDFVQHIVKSSSLMFANPACQPAEYPDTTQSCTDFSKWVAVRLLRVTAAPDCDV
IHGRVSAVLCSLLHTLRIRAPFIFSHLTQELICLAQDLSTILNAHIATLAGLGHTVGIYT
ESQWPVTLECFSISPGCTSSYLTPSSLVLSSPAALESLTAVTIGVITNALRGVVSCHDLN
VAWEMACSILINGNTRLRKISMVMLRKQVELRGFPAMQGHEFFTAYLHLLETHIYTCTAN
AHFNEKPPYEGELLNLTRCVFQSSGTSRTLFEPIYLSQMFECVCTLGGAGVQLGTEVTES
LCLLFHFLVSVAPVYESAAVLRRRRVTEVCRTLTNTVGTENQAECAEGFLQAALKAETAM
VMQESRDGEPAAKILCKSPTDSVSKTTKRACEQDMRVWSEVWAVVNSRLEELLTFLNSDS
VQPESPQTLSALQGLALILHLAALCSSPTSPSAPIWVPTETLGTALKSCQSVLEGSSQPI
TNQSYFHSAVCTVVGVLDSILYMTMSSQGEEGLQQRVCALLSFPWVCENKSASAYKSSRF
PSWLPTLAQRLSFCYSSEIQADCVSLLALLRHGVCETWRVWLLSKALQSTDEVVRAAAVR
AFPLLLHHLGNTHHSLISTTLLPRLDDSSELVRSELARIIGQLSCIQSEVSHLGVTQTES
ICLPKILCRRLSLATEHDGNTFPFLTASVVKPFLKLLRPEAPSSVKQAFLEALPHLCQHV
NLSGGDSDSRAVLCALISLMEDSDPAVRIHFSQSVRFLLTVTGKHSEQDSLSEQLLVARL
KEAFNNAKLQRDDKLRNTLILTTGEIGRASLGNMVSFSLLRLLHCLLSKSSQVSVAAYTQ
IRALAAAKGLKLQTLFSQYKNPICQFLVESLHSRHASALRITPDQSSSSASQRELALDIL
AQIAHAFDFPDLHRFLTRTLQVLLPYLAAKASPIGSALIRTLATELKANRREILISNFKY
IFSHLVCSCTKEELESAFHYLQNETGIELGSLLRQDFQGLHNELLLRLGEHYQQVFNGLA
ILASFASSDDPYQGPRDITTPERMADYLQPKLLGILAFFNMHLLSSSAGEKDRKKLALTG
AMALMRLMGSKHISSVRVKMMTTLRTGLRYREDFPLLCCQTWECFVRSVEPAHLGPLLSH
VIAALLPLIPLQPKETAAIIRFLILDNREEVNEYLHEIYFLPDHPELKDIHTVLQNYKKL
TASSSDLASALQLSMRAVQHENVDVRIHALTSLRDMMHSNQEWLLRHVCASEAVEPVISN
LVSVLLKGCQDSSPEARLLCGECLGELGAVDPGRLDLSHTHTHGDRNTFVSGVDDPNFAY
DVLTELTRTFLAYADDVRAQDSAAYAIQELLSIFECREGRSDSPGRRLWRRFPEQIQEIL
EPHLNSRYKSSQKEVNWSKLKKPVYLSSRGSKFSDWSATWAGYLISKVRHELASKVFTCC
SFIIKHDYKVTIYLLPHILLYMLLGCTPAEQQEVTEEMLAVLTEGDGRAGGRVQETASSL
SQLSTQTVFSMLSHLTQWSRHILYSKPRQSESGEYQRVAAFLKGIPQDVLAKASLRSKAY
TRALMHFEAYILENKEDIQDHLTFLQTLYAAMHEPDGVRGANALRREEPSLREQILEHES
IGLLRDATACYDRAIQLESDQIGHYHGVMTSMLGLGQLSTVITQVNGVLANKPQWKSDLN
TYRVEAAWKLGKWDLLEDYLGSDHQSSTWSVRLGQLLLSAKKQDADTFYEKLKVVRKEQV
VPLSAASYECGTYQRGYEYIVRLHMLSELEHTFTELQKQQEISTLSLSHVPPHWSDRLEM
TQNSFRAKEPILALRRALLSLGSQSVCKELVGECWLQSARVARKAGHHQTAFNALLNAEN
MHLAELVTEKAKWLWSKGDVHQALIVLQKGVAQCFPDDQPLNDPRSLQTKGKAMLLVGRF
MEETANFESNAIMKAYRDVTNLLPEWEDGNFYLAKYYDKVMPMVTDNKLEKQGNLIRYIV
TYFGKALQFGNQYIYQAMPRMLSLWLDFGAKVCECEKAGRADRQMRQELGKINSAMSEHC
ANLAPYQFLTAFSQLISRVCHSSDEVFTVLMNIVAKVFLAYPQQAMWLMTAVSKSSYSMR
MNRCNQILKKAISLKQSLEKFIGDATRLTDKLLELCNKPVDGSCSTLNMNVHFKQLKRLV
EEPTFSQILIPLQLVLIPTLPSTGGANTQHDPFPGQWAYLDGFEDTVEILASLQKPKKIS
LKGSDGRSYTMMCKPKDDMRKDCRLMEFNCLINKCLRKDAESRRRELHIRTYAVIPLNEE
CGIIEWVNNTAGLRHILTKLYKERGIYLSGKELRKLMLPKTAPFEEKLRIHKEVLCARHQ
PIFHEWFLRTFPDPTSWYSSRSAYCRSTAVMSMVGYVLGLGDRHGENILFDSFTGECVHV
DFNCLFNKGETFDVPEVVPFRLTQNMVHAMGPMGTEGLFRQACEVTLRLMRDQREPLMSV
LKTFLHDPLVEWSKQAKGHSKTQANETGEIVNEKAKTHVCDIEQRLQGVIKSRNKVLGLP
LSIEGHVHYLIQEATDDKLLCLMYLGWGPYL
NT seq 7836 nt   +upstreamnt  +downstreamnt
atggaaggactggagatgtccgccatgataccggctcttcaggagctagctagtgtcagc
gctgctcagtacgagcaggcggtgcagaaacctcgacagatcctctgtcagttcattgac
aggatactcacagatgtggatgtcgttgctcttggtctgagtaagaagtccagttcagat
ccagcctgtgtgatgctgctggactttgtgcagcatatagtcaaatcctcatctctgatg
ttcgccaaccctgcctgccagcctgctgagtatccagacaccactcagagctgtaccgac
ttcagtaagtgggtggcggtgcgtttgcttcgtgtcacagctgctccagactgtgatgtc
atccacggacgcgtctctgctgtgttgtgctccttacttcacactctccgaataagggca
ccattcatcttcagccacctcactcaggagctcatttgtctcgcacaggacctcagcacc
atcctgaatgcccacattgccacactggcaggactgggacacactgtgggcatttacaca
gagagccagtggcctgtaacacttgagtgcttcagtatctcccctggttgcacctcctca
tacctcacgccttcctctcttgtcctttcttcgcctgctgccttggagtcactgacagcc
gtgacaattggtgttataacaaatgccctgaggggagtggtctcctgtcatgaccttaat
gtagcctgggagatggcctgctccatcctgatcaatggcaacaccaggctgaggaagatc
tccatggtgatgctgaggaaacaggtggagctgagagggtttcctgcaatgcaaggccat
gaattcttcacagcctacctgcatttgctagaaacgcacatatacacatgcacagccaat
gcacacttcaatgagaaaccgccctatgaaggagagctgctgaatttgacacgctgtgtg
tttcagtcatctgggacctcgcgcacactctttgagcccatctatctctctcagatgttt
gaatgtgtttgtactcttggaggagcaggtgtccagctggggacagaggttactgaatca
ctctgcttgctcttccacttcttagtatctgttgccccagtttacgagagcgcagcagtg
ttacggaggcgacgagtcacagaggtctgcaggacactgacaaacaccgttggaacagaa
aatcaagctgaatgcgcagaggggtttctccaagctgcactgaaggcagagactgctatg
gtgatgcaggagtcaagagatggggagcctgctgccaagatcctttgcaaatctcccacg
gattcagtcagcaaaacaacaaaacgtgcatgtgagcaggacatgcgtgtttggagtgag
gtttgggctgtggtgaacagtcgactggaggagcttctgacctttttgaactcagactct
gtccaacctgaaagtccacagactctctctgctctgcagggtctggccctcatcctccac
ctggcagccctgtgctcctctcccaccagtccttctgctcccatctgggtacctactgag
actctgggaacagctctgaagagctgccagtcagtgttagaaggaagctcccaaccaatc
acaaaccagagctactttcactctgctgtctgcactgttgttggggtccttgactctatc
ttgtacatgacgatgagcagtcagggtgaggaagggctccagcagcgtgtgtgtgctctg
ttatcttttccttgggtgtgtgagaacaagtctgcctcagcctataagagctcaagattc
ccctcttggcttcctaccttggctcagagactcagcttctgttactcatctgagatccag
gcagactgtgtgtcgctgctcgccctcctgcgtcatggtgtgtgtgaaacctggcgtgtg
tggttgctttccaaggcgctgcagagtacagatgaggtggtgagagcagcggcagtcaga
gctttccctcttcttcttcaccacctgggaaacacacaccacagcctcattagcactact
ctgcttcccaggctggacgacagctcggagctggtgaggagcgagcttgccaggatcatc
ggtcagctgagctgtatccagtcagaggtctcccacctcggtgttacccaaacagagtcc
atctgtcttccaaaaatcctctgccgtcgcctcagccttgcaacagagcatgatgggaac
acttttccatttcttacagcatctgttgtcaagccctttctgaagctgctcagacctgaa
gcaccaagcagtgttaaacaagcttttctagaagctctgcctcacctctgccagcatgtg
aatctgagtggtggagacagcgactctcgagcagttctctgtgctctgattagtctaatg
gaagattcagatccagcagtcagaatacatttcagccaatcagtacgtttcctgttaaca
gtgactggcaaacactccgagcaggactctctgagtgagcagctcctggttgcacgtctt
aaggaggcattcaacaacgctaaactccaacgagatgacaaactgcgcaacactctcatc
ctgaccactggagagattggcagagcatcccttggtaatatggtgtcattctctctgctg
cggctgctccactgtctgctgtccaagtcgtcccaagtatctgtagctgcctacacccag
atcagagccctggccgctgccaaaggcctaaagctgcaaaccctcttcagtcagtacaag
aaccccatttgccagttcttggtggagtcactgcactcgcgtcatgcttcggccctgcgg
atcacacccgatcaaagcagctcgtcagccagccagagggagctggctctggacatcttg
gcacagattgcacacgccttcgacttcccagacctccatcgcttcctcaccaggacccta
caggtgctactgccctacctggcagcaaaggcgagccctataggctccgccctcatccgt
acactagccactgagttgaaggcaaacaggagagagatcctcatcagcaatttcaagtac
atctttagccacctggtctgttcctgcaccaaggaggagctggagagtgcctttcactac
ctgcagaacgagactgggattgaactgggctctctgctaagacaagacttccagggtctt
cacaacgagctgttgctgcgtctgggagagcattaccaacaggtatttaatggtctggcg
atcttggcctcctttgcatccagtgatgacccgtaccagggacccagagacatcaccacc
ccagagcgcatggcagactaccttcagccgaagctgctgggaattcttgcctttttcaac
atgcatctgctcagctccagtgcaggagagaaggaccgcaagaagctggcgttgaccggt
gccatggctctaatgcgactgatgggctccaaacacatcagctctgttagagtgaagatg
atgacaacgctccgcacaggcctccgatacagagaggactttcctctgctctgctgccag
acgtgggagtgttttgtgaggagcgtggagcctgcacatctgggccccctgttgagtcac
gtgattgccgcacttctcccactgattcctctacagcccaaagaaactgctgctattata
cgtttcctgatcctagacaacagggaggaagtcaatgaataccttcatgagatttacttc
ctgccagatcaccctgaactgaaagacatccacactgttctgcagaactacaagaagctg
acagcaagcagcagtgacctggcttcagcactgcagctctctatgagagctgttcagcat
gagaacgttgatgtcaggattcatgcactgaccagcctcagggacatgatgcacagcaac
caggagtggctgctgcgccacgtttgtgcgagtgaggctgtggagccagtcatctccaac
ctggtgtcagtgctgctgaagggctgccaggactcgtccccagaagccagactcctctgt
ggggagtgtttgggggagctgggcgccgtggaccctggacgcctggacctgtcgcacaca
cacacccacggcgaccgcaacacctttgtgagtggggttgatgatcctaactttgcctac
gacgtattgactgaactgaccagaacatttctggcttatgctgatgatgtgagagcgcag
gattcagctgcttatgcaattcaggagctgctgtccatctttgagtgtcgagagggtcga
tctgattcaccaggccgccgtctgtggagaagattcccagagcagattcaagaaatactg
gaaccacatctcaacagcaggtataagagcagtcagaaagaggtgaactggtctaaactg
aagaaaccagtgtacctaagcagcagaggcagcaagttctctgattggtcagccacctgg
gctggatacctcatcagcaaggtgagacatgagctggccagcaaggtcttcacctgctgt
agtttcatcatcaagcacgactacaaggtcacaatctacctgctccctcatatcctgctg
tacatgctgctgggctgcacgcctgcagagcaacaggaggtgacggaggagatgctggct
gtgctaacagagggtgacgggcgagcagggggtcgtgtacaggagacggcctcgagcctg
tcgcagctcagcacccagacagtgttcagcatgttgtctcatctcacacagtggagccgc
cacatcctttactccaaacccagacaaagcgagagtggggagtatcagcgtgtggcggcc
tttctaaaaggtattccacaggacgttctggccaaggcctctctgcgttccaaggcgtac
actcgtgccctcatgcactttgaagcttacatcttagaaaacaaagaggacatccaggat
caccttaccttcctgcagacgctttacgctgcgatgcatgagcctgatggagtgaggggg
gccaacgctcttaggagggaggagccgtcgctacgggaacagatactggagcatgagagc
atcggcctgctccgagatgccaccgcctgctacgaccgagccatacagctggagtcagac
cagattggccattatcatggggtgatgacctctatgctgggcctgggacagctgtccaca
gttatcacccaggtcaatggagtactggctaacaagccccagtggaagtcggaccttaac
acttacagagtagaggcagcctggaagcttgggaaatgggacctgctggaagattacttg
ggttcagaccatcagtccagtacctggagtgtgcggcttggccagttgctgctgtcagct
aagaagcaggatgctgacactttctatgagaagctgaaggttgtgagaaaggaacaggtc
gttcctctgtctgcggcgagttacgagtgtggaacctaccagcggggatacgagtacatt
gtcaggcttcacatgctcagtgagctggagcacacttttactgagctgcagaaacagcag
gaaatctccaccctcagtctcagccacgtgcctcctcattggtcagatcgactagagatg
acccagaattcctttagggccaaggagccaatcctggcactgcgtcgggccctgctcagc
ctgggatcacagtctgtgtgtaaggagctggtcggggagtgctggctgcagagcgcccgg
gtggccaggaaggcagggcaccaccagactgcttttaatgctcttctgaatgcagagaac
atgcacctggctgagctggtgacagagaaagccaagtggctttggtccaagggcgatgta
catcaggcactgatcgtcctgcagaagggcgtggcccagtgttttcctgatgatcagcca
ctgaatgaccctcgcagcctgcagactaaaggcaaggccatgctgctggtgggccgcttc
atggaggagacggccaactttgagtccaatgccatcatgaaggcatacagggatgtgacc
aaccttctgcctgagtgggaggatggaaacttctacctggctaagtactatgacaaagtg
atgccaatggtgactgataacaagctggagaaacaggggaacctcatccgatacattgtt
acatactttggaaaagccttgcagtttgggaaccagtacatctaccaggccatgcctcgg
atgctgtctctctggcttgattttggagccaaggtgtgtgaatgtgagaaagctgggcga
gcagacagacagatgcgacaggagctgggaaaaatcaactcggctatgagtgagcactgt
gcgaacctggcgccgtaccagtttctgaccgccttctcccagctcatctccagggtgtgt
cactctagcgatgaggtctttactgttctcatgaacattgtggccaaagttttcctggcg
tacccccagcaggctatgtggctaatgactgctgtctccaagtcttcctactccatgcgt
atgaaccgctgtaatcagatccttaaaaaggccattagtcttaaacagtctctggagaaa
ttcattggagatgccacaaggctgactgacaagctgctagagctctgcaacaagccggtg
gacgggagctgtagcacccttaatatgaacgttcacttcaagcagctgaaacgtttggtg
gaggagccgaccttcagccagatcctgatcccattacagttggtgctcatccctacactg
ccctcgacaggtggagcgaacacgcagcacgaccccttccctggacaatgggcatacctg
gatggctttgaagacactgtggagatcttggcttccctacagaagcctaaaaagataagc
ctgaagggttcagatgggcggagctacaccatgatgtgtaaacccaaagatgacatgagg
aaggactgcagactgatggaattcaactgcctcatcaacaagtgcctacgcaaagatgct
gagtcaaggcggagggagctacacatccgaacctatgctgtgatccccctcaatgaggag
tgtggtatcatcgaatgggtcaacaacactgctggacttcgacacattctcaccaagctg
tataaggagagaggtatctacttatcaggtaaagagctgaggaagcttatgctaccaaag
acagctccgtttgaggagaagctacgaattcacaaggaggtgctgtgtgctcgacaccaa
cctatcttccacgagtggttcctccggaccttccctgaccctacatcatggtacagcagt
cgctctgcgtactgccgctccactgctgtgatgtccatggtgggttatgtcctgggtttg
ggagatcgtcatggagaaaacatcctctttgactctttcactggggaatgtgttcatgtt
gacttcaactgcctctttaacaagggggagacatttgatgtgcctgaggttgtgcccttc
cgtctgacccaaaacatggtccatgctatgggacccatgggcaccgaaggcctcttcaga
caggcctgtgaggtcaccctgagactaatgagagaccagagagagccactcatgagtgtg
cttaagaccttccttcatgacccactggtggagtggagcaaacaagccaaaggacattcc
aaaactcaagccaatgagactggagagatagttaatgaaaaggctaaaacacatgtgtgt
gacatcgagcagcgtctgcaaggagtgataaagagcaggaataaagttctgggtctgcct
ctgtctatagagggacatgtacactacctcatacaggaggccactgatgacaaactgctc
tgtctaatgtatctgggctgggggccctacctctaa

DBGET integrated database retrieval system