KEGG   Methylomusa anaerophila: MAMMFC1_01957
Entry
MAMMFC1_01957     CDS       T05819                                 

Definition
(GenBank) glutamyl-tRNA reductase
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mana  Methylomusa anaerophila
Pathway
mana00300  Lysine biosynthesis
mana01100  Metabolic pathways
mana01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mana00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MAMMFC1_01957
Enzymes [BR:mana01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MAMMFC1_01957
SSDB
Motif
Pfam: Shikimate_DH DAO AlaDh_PNT_C 2-Hacid_dh_C NAD_binding_7 AdoHcyase_NAD 3HCDH_N NAD_binding_8 F420_oxidored FAD_binding_3 TrkA_N NAD_binding_2 UDPG_MGDP_dh_C UDPG_MGDP_dh_N Pyr_redox_2 FAD_binding_2 NAD_Gly3P_dh_N HI0933_like ApbA GIDA Sacchrp_dh_NADP THF_DHG_CYH_C Pyr_redox adh_short XdhC_C Pyr_redox_3 DpaA_N
Other DBs
NCBI-ProteinID: BBB91285
UniProt: A0A348AJN7
LinkDB
Position
2156231..2157046
AA seq 271 aa
MTRLREDDIDTVSARLPAYNETLRRLLGKGLAEVAAYSQAGSPGDFAVWQDTPVGVIPVS
CGQGVIGGFAHTVKEIIAFLGFSSFVTARSDVGGLAEAVQRGAQVVFLADDDHFVAIHLA
KGKVVDNAAATGRGYAAALALLAGGLTGEKALVIGAGPVGAGAAAYLTEQGAQVVIYDSN
PEKSAQLSRAMAGVTAADDMAAALAACRLVVEATPAAGVIDCRDITDRMLVAAPGVPLGI
TPQGEARLSGRLIHDVLEIGVATMLFTVFAD
NT seq 816 nt   +upstreamnt  +downstreamnt
atgaccaggctgcgggaagatgatattgatacggtgagtgcgagactgccggcctacaat
gagaccctgcgccggctcctgggcaaaggtttggcggaggtggcggcctattctcaggcc
ggcagccccggggacttcgccgtctggcaggatacgccggtcggggtgatcccggtttcc
tgcgggcagggtgtgattggcggttttgcccatacagtcaaagagattattgccttcctg
ggcttttcttcttttgttaccgcgcgcagcgatgtcggcgggctggccgaagccgtgcag
cgcggcgcgcaggtggtttttctggccgacgacgaccattttgtggccattcacctggcc
aaaggcaaagtggttgacaacgcggcggcaacaggccgggggtatgcggcggcgctggcc
ttgctggccggcggcctgacaggcgaaaaagcgctggtaatcggcgccggaccggtaggg
gcgggagcggccgcttatttaacggaacagggcgcgcaggttgtaatttatgacagtaat
ccggaaaaatcagcgcagcttagccgggcgatggccggcgtgacggcggctgacgacatg
gcggcggctttggcggcctgccggctggtggtggaggctacgccggcagccggtgtcatt
gactgccgggacattaccgacaggatgctggtggcagccccgggcgtaccgcttggcata
acgccgcagggtgaggccaggctgtctggccggctgatacatgatgtgctggaaatcggc
gtggcgactatgctgtttactgtttttgccgactaa

DBGET integrated database retrieval system