KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_0356Help
Entry
MAP4_0356         CDS       T02662                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
mao00564  Glycerophospholipid metabolism
mao01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mao00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MAP4_0356
Enzymes [BR:mao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MAP4_0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 GIDA Pyr_redox 3HCDH_N HI0933_like Thi4 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AGL35320
LinkDB All DBs
Position
407888..409642
Genome map
AA seq 584 aa AA seqDB search
MSDPIHALGEPGSPASALGPRQRAAAWDRLGAEQFDVVVIGGGVVGSGCALDAATRGLKV
ALVEARDFASGTSSRSSKMFHGGLRYLEQLEFGLVREALYERELSLTTLAPHLVKPMPFL
FPLTNRLWERPYIAAGIFLYDRLGGAKSVPAQKHLTRAGALRLCPGLKRSALIGGIRYYD
TIVDDARHTLTVARTAAHYGVVVRNSTQVVALLREGDRVTGVRVRDSEDGSVTEVRGHVV
VNATGVWTDEIQALSKQRGRFQVRASKGVHVVVPRDRIVSDVAIILRTEKSVMFVIPWGS
HWIIGTTDTDWDLDLAHPAATKADIDYILSTVNTVLAIPLTHADIDGVYAGLRPLLAGES
EETSKLSREHAVAVPAPGLVAIAGGKYTTYRVMAADAIDAAAQFIPARVAPSITEKVSLL
GADGYCALINQAEHVAQLRGLHPYRVRHLLDRYGSLIGDVLALAADRPDLLNPITEAPGY
LRVEALYAVTAEGALHLEDILARRMRISIEYSHRGVDCAREVADVVAPVLGWTAGDVERE
VANYTARVQAEILSQAQPDDVSADELRASAPEARAEILEPVPLN
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatccgatccacgcactcggcgagcccggctcgccggcttcggcgctgggaccg
cggcaacgcgcggcggcctgggacaggctgggcgccgagcagttcgacgtggtggtgatc
ggcggcggcgtggtgggatcgggctgcgcgctggacgccgccacccgcgggctcaaggtt
gcgctggtggaggcccgcgacttcgcgtcgggcacctcgagccgttcctcgaagatgttc
cacggcggcctgcgctatctcgagcagctggagttcgggctggtgcgcgaggccctctac
gagcgcgagctgtcgctgaccacgctggcaccgcacctggtcaagccgatgccctttctg
ttcccgctgaccaatcggttgtgggaacggccctacatcgccgccggcatctttctctac
gaccggctgggcggggcgaaatccgttccggcgcaaaagcatttgacccgcgccggtgcg
ctgcggctgtgcccgggcctcaaacgcagcgcgctgatcggcggaatccgctactacgac
accatcgtcgacgacgcccggcacacactgaccgtcgcgcgcaccgccgcgcactacggc
gtggtggtgcgcaactccacccaggtggtcgccctgctgcgggagggcgaccgggtgacc
ggggtgcgggtgcgcgactccgaagacggctcggtcaccgaggtccgcgggcatgtggtg
gtcaacgcgaccggcgtgtggaccgacgagatccaggcattgtccaagcagcgcgggcga
tttcaggtgcgggcatccaagggggtgcacgtggtggtgccgcgcgaccgcatcgtcagc
gacgtggcgatcatcctgcgcaccgagaagtcggtgatgttcgtcatcccgtggggcagc
cactggatcatcggaaccaccgacaccgactgggatctggacctggcccaccccgcggcc
accaaggccgacatcgactacatcctgtccaccgtcaacaccgtgctggccatacccctc
acccacgccgacatcgacggggtgtatgcggggctgcggccgctgctggccggggagagc
gaggaaacatccaagctctcccgcgagcacgcggtggcggtgcccgcacccggcttggtg
gccatcgccggcggcaagtacaccacctaccgggtgatggctgccgacgcgattgatgct
gcggcgcaattcattccggcccgggtggcgccgtcgatcacggagaaggtcagcctgctg
ggggccgacggctactgcgcgctgatcaatcaggccgagcacgtcgcgcagctgcgcggg
ttgcatccctaccgggtgcgccacctgctggaccgctacggctcgctgatcggtgacgtg
ctggcgctggccgccgatcggcccgacctgctcaacccgatcacggaggcgccgggctat
ctgcgggtggaggcgctgtacgccgtaaccgccgagggcgctttgcatttggaggacatc
ctggcccgccggatgcgcatctccatcgaatactcgcatcgtggcgtcgactgtgcccgc
gaggtggccgacgtggtcgcgccggtgctggggtggacggccggcgacgtcgagcgcgag
gtggccaactacaccgcccgggtgcaggccgagatcctgtcgcaggcccagcccgacgac
gtgtcggccgacgagctgcgcgccagcgcgcccgaggcgcgcgccgagatcctcgagccg
gtgccgctcaattga

DBGET integrated database retrieval system