KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_2815Help
Entry
MAP4_2815         CDS       T02662                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
mao00250  Alanine, aspartate and glutamate metabolism
mao00280  Valine, leucine and isoleucine degradation
mao00310  Lysine degradation
mao00410  beta-Alanine metabolism
mao00640  Propanoate metabolism
mao00650  Butanoate metabolism
mao01100  Metabolic pathways
mao01120  Microbial metabolism in diverse environments
Module
mao_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MAP4_2815
   00650 Butanoate metabolism
    MAP4_2815
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MAP4_2815
   00280 Valine, leucine and isoleucine degradation
    MAP4_2815
   00310 Lysine degradation
    MAP4_2815
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAP4_2815
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mao01007]
    MAP4_2815
Enzymes [BR:mao01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MAP4_2815
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MAP4_2815
    2.6.1.48  5-aminovalerate transaminase
     MAP4_2815
Amino acid related enzymes [BR:mao01007]
 Aminotransferase (transaminase)
  Class III
   MAP4_2815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AGL37695
LinkDB All DBs
Position
3119430..3120779
Genome map
AA seq 449 aa AA seqDB search
MARLEQTRRLVTEIPGPASLELSKRRAAAVSHAVNVSVPVFVARAGGGIVEDVDGNRLID
LGSGIAVTTIGNSAPRVVDAVRAQVAEFTHTCFMVTPYESYVAVAEMLNRITPGAGDKRS
VLFNSGAEAVENAVKVARAYTRKPAVVAFDHAYHGRTNLAMALTAKSMPYKGGFGPFAPE
IYRAPLSYPYRDGLLDKELATDGEKAAARAINIIDGQIGADSLAAVIIEPIQGEGGFIVP
VEGFLPTLLDWCRRNDVLFIADEVQTGFARSGAMFACEHEGPNGLEPDLICTAKAIADGL
PLSAVTGRAQIMDAPHVGGLGGTFGGNPLACAAALATIETIESDGLIERARQLERLITEP
LLRLQARDDRIGDVRGRGAMIAIELVKSGTAEPDKDLTQRLSVAAHAAGVIVLTCGMFGN
IIRLLPPLTISDELLAEGIDILGGLLADL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggccaggctcgagcagactcgccggctggtcaccgagatccccggcccggcgtcgctg
gagctgagcaaacgccgcgcggcggcggtgtcgcacgcggtcaacgtgtcggtgccggtg
ttcgtcgcccgcgccggcggcggcatcgtcgaggacgtcgacggcaaccggctcatcgac
ctcggctccggcatcgcggtgaccaccatcggcaactcggcgccccgggtggtcgacgcg
gtgcgcgcccaggtggccgagttcacccacacctgcttcatggtgacgccgtacgagtcc
tacgtcgccgtcgccgaaatgctgaaccggatcacccccggtgccggtgacaagcgctcg
gtgctgttcaactccggcgccgaggccgtcgagaacgccgtcaaggtcgcccgcgcctac
acccgtaagccggccgtggtggccttcgaccacgcctaccacggccgcaccaacctggcg
atggcgctgaccgcgaagtcgatgccctacaagggcggcttcggcccgttcgcgccggag
atctaccgggcgccgctgtcctacccctaccgggacgggctgctcgacaaggaactggcc
accgacggggagaaggccgccgcgcgggccatcaacatcatcgacggccagatcggcgcc
gacagcctggccgcggtgatcatcgaaccgatccagggcgagggcgggttcatcgttccc
gtcgaaggattcctgcccaccctgctggactggtgccgccgcaacgacgtgctgttcatc
gccgacgaggtgcagaccgggttcgcgcggtccggcgccatgttcgcctgcgagcacgag
ggcccgaatggtttagagccggacctgatctgcaccgccaaggccatcgccgacgggctg
ccgctgtcggcggtcaccggccgcgcccagatcatggacgccccgcacgtcgggggcctg
ggcggcaccttcggcggcaacccgctggcgtgcgcggcggcgctggccaccatcgagacg
atcgagagcgacggcctgatcgaacgggcccggcagctggaacgcctgatcaccgaaccg
ctgctgcgcctgcaggcccgcgacgaccggatcggcgacgtccgcggccggggcgccatg
atcgccatcgaactggtgaagtccggcaccgccgagccggacaaggacctgacccagcgg
ctgtccgtcgccgcgcacgcggccggcgtcatcgtgctcacctgcggcatgttcggcaac
atcatccggctgctgccgccgctgaccatcagcgacgagctgctcgccgagggcatcgac
attctcggcgggttgttggccgacctgtaa

DBGET integrated database retrieval system